Difference between revisions of "Os01g0307500"
Liushuaiye (talk | contribs) (→Annotated Information) |
|||
| Line 1: | Line 1: | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
| + | |||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | This gene control the express of the protein HKT family. The HKT family of Na+ and Na+/K+ transporters is implicated in plant salinity tolerance. The cereal HKT1;4 and HKT1;5 are responsible for Na+ exclusion from photosynthetic tissues, a key mechanism for plant salinity tolerance. | |
| + | We previously mapped a rice QTL, SKC1, that maintained K+ homeostasis in the salt-tolerant variety under salt stress<ref name="pmid:14513218" />, consistent with the earlier finding that K+ homeostasis is important in salt tolerance <ref name="pmid:15347782" />. | ||
| + | It encoded a member of HKT-type transporters. SKC1 is preferentially expressed in the parenchyma cells surrounding the xylem vessels. Voltage-clamp. | ||
| + | SKC1 protein functions as a Na+-selective transporter. Physiological analysis suggested that SKC1 is involved in regulating K+/Na+ homeostasis under salt stress, providing a potential tool for improving salt tolerance in crops. | ||
| + | Up-regulation of OsNRT1;2, a gene coding nitrate transporter, might contribute to the accumulation of NO3 - in the old leaves of salt stressed-rice. Salt stress clearly up-regulated the expression of OsGDH2. | ||
===Expression=== | ===Expression=== | ||
| − | + | The work described here provides evidence for a crucial amino acid substitution which determines Na+ transport efficiency of OsHKT1;5. The recently solved structure of a highly similar TrkH K+ transporter<ref name="pmid:21317882 " />provided the basis for three-dimensional(3D) molecular modeling of OsHKT1;5 and OsHKT1;4. | |
| + | Different HKT members may have different transport properties.The founding member of the HKT family, TaHKT1, mediates K+/Na+symport and Na+ transport whereas AtHKT1 selectively transportsNa+. In rice, OsHKT1, like AtHKT1, transports Na+only and OsHKT2 mediates TaHKT1-like K+/Na+ symport. Toassess the functional property of SKC1.<ref name="pmid:7502075 " />,<ref name="pmid:8953248 " />. NSKC1 is a more active allele than KSKC1,which might contribute to the difference in ionic homeostasis and salt tolerance, a salt-sensitive allele of AtHKT1 encodes a mutant protein with lower transport activity<ref name="pmid:12727868 " />.The KSKC1 allele encodes a protein with lower transport activity that also leads to a salt sensitive phenotype in rice seedlings. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | Comparison of the genomic and cDNA sequences of the Nona Bokra allele of SKC1 identified three exons and two introns. SKC1 is predicted to encode a 554–amino acid polypeptide of B60 kDa. Database searches showed substantial similarity between SKC1 and the HKT-type transporters found in plants, bacteria and fungi8–10. SKC1 protein showed 44%, 48%, 44%, and 41% identity to wheat TaHKT1, Arabidopsis thaliana AtHKT1 <ref name="pmid: 10759522 " /> and rice OsHKT1 and OsHKT4 <ref name="pmid: 12795699 " />, respectively. Seven HKT members and two pseudo genes have been identified from the rice genomic database by homology search12. SKC1 corresponded to OsHKT8. The physiological function of HKT members in rice has not previously been studied. | |
| + | |||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Nature Publishing Group, Australian Centre for Plant Functional Genomics,University of Adelaide, Adelaide, South Australia, Australia, Key laboratory of Molecular Epigenetics of MOE,Northeast Normal University, Changchun 130024 Jilin Province, China,Northeast Institute of Geography and Agricultural Ecology,Chinese Academy of Sciences. | ||
| + | |||
| + | ==References== | ||
| + | <references> | ||
| − | + | <ref name="pmid:14513218">Lin, H.X. et al. QTLs for Na+ and K+ uptake of shoot and root controlling rice salt tolerance. Theor. Appl. Genet. 108, 253–260 (2004). </ref> | |
| + | <ref name="pmid:15347782" />Qi, Z. & Spalding, E.P. Protection of plasma membrane K+ transport by the salt overlysensitive1 Na+/H+ antiporter during salinity stress. Plant Physiol. 136, 2548–2555 | ||
| + | (2004). </ref> | ||
| + | <ref name="pmid:21317882 " />Cao Y, Jin X, Huang H, Derebe MG, Levin EJ, et al. (2011) Crystal structure of a potassium ion transporter, TrkH. Nature 471: 336–340. </ref>. | ||
| + | <ref name="pmid: 7502075 " />Rubio, F., Gassmann, W. & Schroeder, J.I. Sodium-driven potassium uptake by theplant potassium transporter HKT1 and mutations conferring salt tolerance. Science | ||
| + | 270, 1660–1663 (1995). </ref> | ||
| + | <ref name="pmid: 8953248 " />Gassman, W., Rubio, F. & Schroeder, J.I. Alkali cation selectivity of the wheat root highaffinity potassium transporter HKT1. Plant J. 10, 869–882 (1996). </ref> | ||
| + | <ref name="pmid:12727868 " />Berthomieu, P. et al. Functional analysis of AtHKT1 in Arabidopsis shows that Na+recirculation by the phloem is crucial for salt tolerance. EMBO J. 22, 2004–2014 (2003). </ref> | ||
| + | <ref name="pmid: 10759522 " />Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref> | ||
| + | </references> | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 12:59, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
This gene control the express of the protein HKT family. The HKT family of Na+ and Na+/K+ transporters is implicated in plant salinity tolerance. The cereal HKT1;4 and HKT1;5 are responsible for Na+ exclusion from photosynthetic tissues, a key mechanism for plant salinity tolerance. We previously mapped a rice QTL, SKC1, that maintained K+ homeostasis in the salt-tolerant variety under salt stress[1], consistent with the earlier finding that K+ homeostasis is important in salt tolerance [2]. It encoded a member of HKT-type transporters. SKC1 is preferentially expressed in the parenchyma cells surrounding the xylem vessels. Voltage-clamp. SKC1 protein functions as a Na+-selective transporter. Physiological analysis suggested that SKC1 is involved in regulating K+/Na+ homeostasis under salt stress, providing a potential tool for improving salt tolerance in crops. Up-regulation of OsNRT1;2, a gene coding nitrate transporter, might contribute to the accumulation of NO3 - in the old leaves of salt stressed-rice. Salt stress clearly up-regulated the expression of OsGDH2.
Expression
The work described here provides evidence for a crucial amino acid substitution which determines Na+ transport efficiency of OsHKT1;5. The recently solved structure of a highly similar TrkH K+ transporter[3]provided the basis for three-dimensional(3D) molecular modeling of OsHKT1;5 and OsHKT1;4. Different HKT members may have different transport properties.The founding member of the HKT family, TaHKT1, mediates K+/Na+symport and Na+ transport whereas AtHKT1 selectively transportsNa+. In rice, OsHKT1, like AtHKT1, transports Na+only and OsHKT2 mediates TaHKT1-like K+/Na+ symport. Toassess the functional property of SKC1.[4],[5]. NSKC1 is a more active allele than KSKC1,which might contribute to the difference in ionic homeostasis and salt tolerance, a salt-sensitive allele of AtHKT1 encodes a mutant protein with lower transport activity[6].The KSKC1 allele encodes a protein with lower transport activity that also leads to a salt sensitive phenotype in rice seedlings.
Evolution
Comparison of the genomic and cDNA sequences of the Nona Bokra allele of SKC1 identified three exons and two introns. SKC1 is predicted to encode a 554–amino acid polypeptide of B60 kDa. Database searches showed substantial similarity between SKC1 and the HKT-type transporters found in plants, bacteria and fungi8–10. SKC1 protein showed 44%, 48%, 44%, and 41% identity to wheat TaHKT1, Arabidopsis thaliana AtHKT1 [7] and rice OsHKT1 and OsHKT4 [8], respectively. Seven HKT members and two pseudo genes have been identified from the rice genomic database by homology search12. SKC1 corresponded to OsHKT8. The physiological function of HKT members in rice has not previously been studied.
Labs working on this gene
Nature Publishing Group, Australian Centre for Plant Functional Genomics,University of Adelaide, Adelaide, South Australia, Australia, Key laboratory of Molecular Epigenetics of MOE,Northeast Normal University, Changchun 130024 Jilin Province, China,Northeast Institute of Geography and Agricultural Ecology,Chinese Academy of Sciences.
References
- ↑ Lin, H.X. et al. QTLs for Na+ and K+ uptake of shoot and root controlling rice salt tolerance. Theor. Appl. Genet. 108, 253–260 (2004).
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:15347782 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:21317882 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:7502075 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:8953248 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:12727868 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:_10759522 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedpmid:_12795699
Cite error: <ref> tag with name "pmid:_7502075" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "pmid:_8953248" defined in <references> is not used in prior text.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0307500 |
|---|---|
| Description |
Cation transporter family protein |
| Version |
NM_001049383.1 GI:115436179 GeneID:4327757 |
| Length |
4487 bp |
| Definition |
Oryza sativa Japonica Group Os01g0307500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:11506912..11511398 |
| Sequence Coding Region |
11507243..11507441,11508119..11508349,11509997..11511231 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:11506912..11511398 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:11506912..11511398 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgagttctctggatgccactactcctagatatgacgagtttaaaaggatctaccaccttttccttttccatgcacacccattctggctccaactgctgtacttcctcttcatctccctcttgggtttcttgatgctgaaagctctgccgatgaagaccagcatggtgccgaggcccatggacttggacctgatcttcacgtcggtgtcggcgacgacggtgtcgagcatggtcgccgtcgagatggagtccttctccaactcccagctcctcctcatcaccctcctcatgctgcttggtggtgaggtcttcaccagcatccttggcctctacttcaccaacgccaagtactcctccaagatgatagcaaccttacctgatgatgacgaccatggtggcagtggcaaaccaccaccaccaacgacgtcaccttcgtctaccctagtggagctcgagctcgctcctcccatggacgtcgtcgtcgtcaaccctaccaccactgcgacgacgcacgacgaggtagagctagggttaggacgtcggaacaagcgcggctgcacctgcactactactcacacgtcgtcgtcatcatcggcatcgaagacgacgacgacgaggctactgatgttcgtggtgatggggtaccacgcggtggtgcacgtcgccgggtacacggccatcgtcgtgtacctcagcgccgtcggcggcgcgggggcggtggtcgccgggaaggggatcagcgcgcacacgttcgccatcttcaccgtcgtctcgacgttcgccaactgcgggttcgtgccgacgaacgaagggatggtgtcgttcaggtcgttcccggggctcctcctcctcgtcatgccgcacgtcctcctcgggaacacgctcttcccggtcttcctcaggctggccatcgccgcgctcgagagggtcaccgggtggccggagctcggcgagctcctgatccggcggcggaggggcggcggcgagggctaccaccacctgttgccgagctcgcgcacgcggttcctggccctcaccgtggccgtgctcgtggtggcgcagctggcgctcttctgcgccatggagtggggctccgacgggctgcgggggctcaccgcgggccagaagctcgtcggcgcgctcttcatggcggtcaactcgaggcactccggtgagatggtgctcgacctctccaccgtgtcgtcggccgtcgtcgtgctctacgtggtgatgatgtacctgccaccttacaccactttcgtacctgtccaagacaaacaccagcaaacgggagcacagtccgggcaggagggcagcagcagcagcagcatatggcagaagctgctcatgtcgccgctctcgtgcctagccatcttcatcgtcgtcatctgcatcacggagcggcggcaaatcgccgacgaccccatcaactacagcgtcctcaacatcgtcgtcgaggttatcagtgcgtatggcaatgtggggttcagcacggggtacagctgcgcgaggcaggtgaggcccgacggcagctgcagagacctgtgggttggcttctcagggaagtggagcaaacaagggaagctcactctcatggccgtcatgttctacggcaggctcaagaagttcagcctgcacggtggtcaggcatggaagatagaataa</cdnaseq> |
| Protein Sequence |
<aaseq>MSSLDATTPRYDEFKRIYHLFLFHAHPFWLQLLYFLFISLLGFL MLKALPMKTSMVPRPMDLDLIFTSVSATTVSSMVAVEMESFSNSQLLLITLLMLLGGE VFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKPPPPTTSPSSTLVELELAPPMDVV VVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSSSSASKTTTTRLLMFVVMGYHAV VHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTVVSTFANCGFVPTNEGMVSFR SFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPELGELLIRRRRGGGEGYHHL LPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQKLVGALFMAVNSRHSGE MVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQEGSSSSSIWQKLLM SPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGFSTGYSCARQVRP DGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKIE</aaseq> |
| Gene Sequence |
<dnaseqindica>3958..4156#3050..3280#168..1402#gctgttgctcttgttcacttgtgctcacagcacctggtaaccccacatacagtgatcacacaacaaacaatatctgttgtttgtgtataaatagccctaacatggcttcctaattcctataaacaacaagtgtgagaaaacccaagaacgaaacacataggagagaaatgagttctctggatgccactactcctagatatgacgagtttaaaaggatctaccaccttttccttttccatgcacacccattctggctccaactgctgtacttcctcttcatctccctcttgggtttcttgatgctgaaagctctgccgatgaagaccagcatggtgccgaggcccatggacttggacctgatcttcacgtcggtgtcggcgacgacggtgtcgagcatggtcgccgtcgagatggagtccttctccaactcccagctcctcctcatcaccctcctcatgctgcttggtggtgaggtcttcaccagcatccttggcctctacttcaccaacgccaagtactcctccaagatgatagcaaccttacctgatgatgacgaccatggtggcagtggcaaaccaccaccaccaacgacgtcaccttcgtctaccctagtggagctcgagctcgctcctcccatggacgtcgtcgtcgtcaaccctaccaccactgcgacgacgcacgacgaggtagagctagggttaggacgtcggaacaagcgcggctgcacctgcactactactcacacgtcgtcgtcatcatcggcatcgaagacgacgacgacgaggctactgatgttcgtggtgatggggtaccacgcggtggtgcacgtcgccgggtacacggccatcgtcgtgtacctcagcgccgtcggcggcgcgggggcggtggtcgccgggaaggggatcagcgcgcacacgttcgccatcttcaccgtcgtctcgacgttcgccaactgcgggttcgtgccgacgaacgaagggatggtgtcgttcaggtcgttcccggggctcctcctcctcgtcatgccgcacgtcctcctcgggaacacgctcttcccggtcttcctcaggctggccatcgccgcgctcgagagggtcaccgggtggccggagctcggcgagctcctgatccggcggcggaggggcggcggcgagggctaccaccacctgttgccgagctcgcgcacgcggttcctggccctcaccgtggccgtgctcgtggtggcgcagctggcgctcttctgcgccatggagtggggctccgacgggctgcgggggctcaccgcgggccagaagctcgtcggcgcgctcttcatggcggtcaactcgaggcactccggtgagatggtgctcgacctctccaccgtgtcgtcggccgtcgtcgtgctctacgtggtgatgatgtatgtatatttgtcctcctcaattattatatttttgacaggccctccttaatatattaattactatcacatgcatgtgtgcacacgtaaaaactaaataaattaccatatcatacatgtgggtacttaatttagtactctggcctgggacatattttaaatcctattggacatctcctttcaattttttttttgaaacaaagtaaaaacgcaggcgcttataacgcgtgcacactcacccttatgaatacaaatcttacccctataagtaccttcgaaagactgagctgacatatcttgagattgacgaagtcatcacgggtatctcactgtcaacaagtacatcactacctaccactaaaagaataattagccataaatacaagcacccgtgtcaaatttattatttgaatctttcattctaattatatgcgatcaaaatagttatgaaaaattctactttatatgggggtgcagggtctcgaggcatctaaatagttatgaaaaaatctataaaaatataagagatatatggtcttcgatgctgtggcacaagtggactagtggttgtcattttacgcgctcaaaatgtaaccgaacgaggcgccgtcatggatcactatcaaaagcagcttagtaccgaattaacatatgtggctacaaatgctaatcagctaaatgataggaaagattgattgctactgatagacatggattgacgctttcagtttgttggagcccttgatttggcactttcacgacgataatccgcaaggataattctccaagtcatattttgcaacaaaatacaactacatctagtttaatttcctctaagttagtaagttgtgactgcaaattaacaagtgtattgatgtccgaaacctagctagatgaaggttatgtacattggatagggatcgaaagaaaatagacagaaacagagaacgataagtcaactgcaagcacatactcccttcatactcataaaggaagtcgtttaagacaatgtttaagtcaaaccttgagattataaatcataaataactctcaagttgttgagtttgaaaatgtaaaaattatatgaataaatttgtcttgaaaaatactttcataaaagtatacatatatcacttttcaatgaatatttttatagaaagaagaagtcaaagttgtattttggagaccgtgtcgatgtcctaaacgactttctttatgaggatggagggagtatatatactctgtacttaagtatacgataatgttatctttgttcagtgaaacttttggaactttgattgttactagctatcaaaatgtttagtttgagaatataaaaattattaatattataattttgttagatattatcgttatgttttaataaaacaacggtggtcaaagtagtacacaccaaacaccgaatgaagtcaacatcggtgtgtgtatatatatacgcggaggtagtacatggtacaacttttgaattaaactcccgaaaaacatatgttctcatgcatgcttttgtatacagatatgatatagctctaaattaataacttgcatgacggaaattgaacatatttgctacactgaattatactgcgtgaaccttaatttgcttatatattctcatgcttgctgcaggtacctgccaccttacaccactttcgtacctgtccaagacaaacaccagcaaacgggagcacagtccgggcaggagggcagcagcagcagcagcatatggcagaagctgctcatgtcgccgctctcgtgcctagccatcttcatcgtcgtcatctgcatcacggagcggcggcaaatcgccgacgaccccatcaactacagcgtcctcaacatcgtcgtcgaggttatcaggtacgcatagtggtggtctaaccttaattttaactgctggcaagtgccaaaaaattactctctccatctctaaatatttgacgccgttgactttttaaaacattttgaccgttcgtcttatcaaaatttttaagtaattattaattcttttcctatcatttgatttattactaaatatatttttatgtatacatataattttacatatttctcaaaagtttttgaataagacgaacggttaaacatgtttaaaaaagtcaacaacgtcaaatatttagggacagagagtatatttcccccttgagggtacatacatttctcctcgtttttatatgtcatcccaaaaattacaaaagaaaatctaaaagttattgataaaatggacatgtgatatattactacactaatatatacacgttcaaatataacttgaacacatgttagaaaaacacaataaatttaactataaatggcatgttcaattcgcaattaaatttaatattttatttctgtttgaacaaattgaatatcatatatttaaaaagagattaattaatgattttttaaacgaatggataaaataagagaaagtgaggaaaatccacatccacggagataatatatataactagaaccatcgtgtaaactaactatatgttacatactcctggatgcagtgcgtatggcaatgtggggttcagcacggggtacagctgcgcgaggcaggtgaggcccgacggcagctgcagagacctgtgggttggcttctcagggaagtggagcaaacaagggaagctcactctcatggccgtcatgttctacggcaggctcaagaagttcagcctgcacggtggtcaggcatggaagatagaataacgcctaactgcaagcacccatgcatgcatgacaacttcgttactaattaatggggcatttcagccggccgccgtactagactacaagagatcgatcgataggtctcccctcctaaaactcctccttaatctgatctccacgagttcttgatcagggttacttatatattataaaggaatgatcagataaatatatgtctatatcaggatctggtcgatctctagatatctgtcttttttttttttgggtaatgcatgtaagcaagtagcaattgctagacatatatatgtgttagcttacgagagtatatactggcgcttgagtcgtgatg</dnaseqindica> |
| External Link(s) |