Difference between revisions of "Os03g0718600"

From RiceWiki
Jump to: navigation, search
Line 5: Line 5:
 
Plant cytoplasmic male sterility (CMS) results from incompatibilities between the organellar and nuclear genomes and prevents self pollination, enabling hybrid crop breeding to increase yields.The Wild Abortive CMS (CMS­WA) has been exploited in the majority of ‘three­line’ hybrid rice production since the 1970s, but the molecular basis of this trait remains unknown.
 
Plant cytoplasmic male sterility (CMS) results from incompatibilities between the organellar and nuclear genomes and prevents self pollination, enabling hybrid crop breeding to increase yields.The Wild Abortive CMS (CMS­WA) has been exploited in the majority of ‘three­line’ hybrid rice production since the 1970s, but the molecular basis of this trait remains unknown.
 
Plant mitochondrial genomic transformation is currently infeasible, but CMS gene function can be tested by nuclear transformation of candidate gene(s) fused with a mitochondrial transit signal (MTS)[1,2]
 
Plant mitochondrial genomic transformation is currently infeasible, but CMS gene function can be tested by nuclear transformation of candidate gene(s) fused with a mitochondrial transit signal (MTS)[1,2]
The suppression of the WA352-interacting gene O. sativa COX11(OsCOX11) can produce male sterility (Fig. 1c,dand Supplementary Fig. 2b).
+
The suppression of the WA352-interacting gene O. sativa COX11(OsCOX11) can produce male sterility.
 
+
[[File:Figure1-d.png|right|thumb|150px|"Figure1. OsCOX11 RNAi was driven by the rice RTStapetum-specific promoter"]]
 
COX11 proteins are conserved in eukaryotes and function in the assembly of cytochrome c(Cyt c) oxidase[3]
 
COX11 proteins are conserved in eukaryotes and function in the assembly of cytochrome c(Cyt c) oxidase[3]
[[File:Supplementary fig 8.png]]
+
[[File:Supplementary fig 8.png|right|thumb|200px|"Figure2. Multiple alignments of COX11 protein sequences of five plant species and yeast. Accession numbers of the protein sequences are given in parenthesis: OsCOX11 of O. sativa (ABF98570), ZmCOX11 of Zea mays (ACG32461), SbCOX11 of Sorghum bicolor"]]
  
 
===Expression===
 
===Expression===

Revision as of 17:25, 7 June 2014

In CMS­WA lines, WA352 accumulates preferentially in the anther tapetum, thereby inhibiting COX11 function in peroxide metabolism and triggering premature tapetal programmed cell death and consequent pollen abortion.

Annotated Information

Function

Plant cytoplasmic male sterility (CMS) results from incompatibilities between the organellar and nuclear genomes and prevents self pollination, enabling hybrid crop breeding to increase yields.The Wild Abortive CMS (CMS­WA) has been exploited in the majority of ‘three­line’ hybrid rice production since the 1970s, but the molecular basis of this trait remains unknown. Plant mitochondrial genomic transformation is currently infeasible, but CMS gene function can be tested by nuclear transformation of candidate gene(s) fused with a mitochondrial transit signal (MTS)[1,2] The suppression of the WA352-interacting gene O. sativa COX11(OsCOX11) can produce male sterility.

"Figure1. OsCOX11 RNAi was driven by the rice RTStapetum-specific promoter"

COX11 proteins are conserved in eukaryotes and function in the assembly of cytochrome c(Cyt c) oxidase[3]

"Figure2. Multiple alignments of COX11 protein sequences of five plant species and yeast. Accession numbers of the protein sequences are given in parenthesis: OsCOX11 of O. sativa (ABF98570), ZmCOX11 of Zea mays (ACG32461), SbCOX11 of Sorghum bicolor"

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0718600

Description

Cytochrome c oxidase assembly protein CtaG/Cox11 family protein

Version

NM_001057624.2 GI:297601593 GeneID:4333922

Length

2954 bp

Definition

Oryza sativa Japonica Group Os03g0718600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:29862461..29865414

Sequence Coding Region

29862661..29862762,29862860..29862940,29863453..29863557

Expression

GEO Profiles:Os03g0718600

Genome Context

<gbrowseImage1> name=NC_008396:29862461..29865414 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:29862461..29865414 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gtgaaggttaaacctggtgaaagtgctcttgcattttatactgctgaaaatcgtagttcagctccaataactggtgtatccacatataacgtagctcctatgaaggctgcaatatatttcaataagatacaatgtttttgctttgaggagcaaacacttcttccaggggagcagattgacatgccggtgttcttctacatcgatcctgagtttgagacagaccccaaaatggaaggggtgaacaatattgtcctttcttacacattctttaaggtgaacgacagttaa</cdnaseq>

Protein Sequence

<aaseq>VKVKPGESALAFYTAENRSSAPITGVSTYNVAPMKAAIYFNKIQ CFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMEGVNNIVLSYTFFKVNDS</aaseq>

Gene Sequence

<dnaseqindica>2653..2754#2475..2555#1858..1962#gtagcgtcgaacaccgtacagcgaatcgcggcggcggaatcacacatcgccgcctctcgcacgcgccgccgcgatgccgccgccgccgccgccttcgttggccaggctccaccaacgcctctccctctcgctcctccggggacgctccccccccgcggcggccgacgccttcctccgccgcgggctcgcctcgtccgcctcctcctcctcttccgccgccgccgccgcggcggtggcggcggcggcggcaggccgggagaagagctcgaggaggacgctagcgtacctgctaggcgtggccgcggcgatggtcggcgcctcctacgccgccgtcccgctctaccgccgcttctgccaggccaccggctatggcggcaccgtccagcgccgcgaggtctggtcttcatttccctaacttgcctctatctttcttgttctcaatcgtaatatgctgaaattaacactgtgctgggacatcgattaagctgtgcttgattttgtggatagcgtctggttccattattggcaggttttagttttacaatctgctgcttggcactgtgatatgctgaaattgatgcgattcatcagctatgtggcctttgtcatgtggagaccgccgttccagttcttatagatgccatggacacgaacgtgttgttgtattgccatgtgtaaattatgagtctagaagattgtaatctattgatagatggcacttcctctcgccgcctctcgcctctcgcactctgcattctattaacaactatgaatatctgtgctggaatttgttaaaatgcccatcaaagggtgatcttacaaatgtgttgggagtggcatgaaatagtttttgattcatttttggtgcttgtatggataactggtctaagtagacattgctgaagcagggttattgttggactctatgaattctgtcaaaaaatagtaataaattttctgggtagtgaatcattcattattcattactggtgcattgaaaaagttctgataaatttggcatctttgtaactacctgattcaagtgagtttgaacctggagtattattccttaacaatgtttggctctctacagagtgtggaggagaagatctcacgacatgctcgagacggaacaacaacttcaaggtgactcttcctatgcccagggtccagttttttcactacttgtcgtttccagttccgaaaggcagtgccatggtggtttttaaaatatactttctatctcttgatagagccttgttgcaatgtgagctcaaactaggcctgtgttgccgatctgttgcctgttgtgtaaattttcctttactgttctcttacatgatcagatggctttttgccaatgtttatggttcagaagtaccttcatttcaaatagtgggatgacatgaaaccacatgtgatgatagatttagatgaagtttaacttggaatagccatacagccttgccagcaattgcatgtgtacagcaaatttgctgtaatcatgggctaatattttggaaaaccattatcttcatgtttatatgattgcaactaattacaagagtttcgggataaatttttaaatgaatttgttgtttcttgtttatccaaataatctcgtgtgctaaaatttagctgtgattcagttttttgatgacactttattttctttgctgttgagactaatgcaattaattttatttgcagagagataattgtccaatttaatgctgacgttgctgatggaatgccgtggaaattcattccaacacagagagaagtaaatgctttgcttaagaaacaatttatagccctttccgcagcatgtttatcctctacctattccatttgtaggtgaaggttaaacctggtgaaagtgctcttgcattttatactgctgaaaatcgtagttcagctccaataactggtgtatccacatataacgtagctcctatgaaggtatgtaattcagcacaacttttacacccttaaactgctgccatgtcctggaaagaaagatttgtgagagatgcagaagtgtctctggattcacaaagctactgtaggcctttaactcttaatcctttgttaattttgttagcctaaattagtggaaatatgttggatgtaatcctttaacttttaatcctatattcttttttgttaaatatgttaagttaaatagccccaactctcaagcatgatttctaggaagaaaatttttgaaaccattagccatgattagacttcctcaactgataagagtttgaaaactgtgatcagaaaattgtagaaaacataacctctgctgtgatattcttagtcaaggagtgactcaggtgacttcacaatatcatcctatttatgttgctaactcaaattatgctgaggtgtacagctagggcatttaagctaacaggaggcagactcctaatgttttgagtttacaactcttttctttcatcctgtaggctgcaatatatttcaataagatacaatgtttttgctttgaggagcaaacacttcttccaggggagcagattgacatgccggtaaattcaacttgcattcgatgaaatgcatggctagttagttatctggtgtttgtctacacttattccaactttgtatgtgaacttttttcttcaggtgttcttctacatcgatcctgagtttgagacagaccccaaaatggaaggggtgaacaatattgtcctttcttacacattctttaaggtgaacgacagttaattgtatcggtaccgtaaagtaagtggtaacattagttctatttaaacaccttgccaacgagtaacacaaaaattcctttcatgtaacacaagttagggttttgtttagtgtgtattaattgacatgtgtttcttggaaattttgcaaataaatatgtaagaattgttcacagaacaatcgaaatggtgcatcttgatttg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0718600, RefSeq:Os03g0718600