Difference between revisions of "Os03g0718600"
(→Labs working on this gene) |
(→References) |
||
| Line 30: | Line 30: | ||
==References== | ==References== | ||
1. Wang, Z. et al. Cytoplasmic male sterility of rice with boro II cytoplasm is caused by a cytotoxic peptide and is restored by two related PPR motif genes via distinct modes of mRNA silencing. Plant Cell 18, 676–687 (2006). | 1. Wang, Z. et al. Cytoplasmic male sterility of rice with boro II cytoplasm is caused by a cytotoxic peptide and is restored by two related PPR motif genes via distinct modes of mRNA silencing. Plant Cell 18, 676–687 (2006). | ||
| + | |||
2. He, S., Abad, A.R., Gelvin, S.B. & Mackenzie, S.A. A cytoplasmic male sterilityassociated mitochondrial protein causes pollen disruption in transgenic tobacco. Proc. Natl. Acad. Sci. USA 93, 11763–11768 (1996). | 2. He, S., Abad, A.R., Gelvin, S.B. & Mackenzie, S.A. A cytoplasmic male sterilityassociated mitochondrial protein causes pollen disruption in transgenic tobacco. Proc. Natl. Acad. Sci. USA 93, 11763–11768 (1996). | ||
| + | |||
3. Banting, G.S. & Glerum, D.M. Mutational analysis of the Saccharomyces cerevisiae cytochrome c oxidase assembly protein Cox11p. Eukaryot. Cell 5, 568–578 (2006). | 3. Banting, G.S. & Glerum, D.M. Mutational analysis of the Saccharomyces cerevisiae cytochrome c oxidase assembly protein Cox11p. Eukaryot. Cell 5, 568–578 (2006). | ||
| + | |||
4. Veniamin, S., Sawatzky, L.G., Banting, G.S. & Glerum, D.M. Characterization of the peroxide sensitivity of COX-deficient yeast strains reveals unexpected relationships between COX assembly proteins. Free Radic. Biol. Med. 51, 1589–1600 (2011). | 4. Veniamin, S., Sawatzky, L.G., Banting, G.S. & Glerum, D.M. Characterization of the peroxide sensitivity of COX-deficient yeast strains reveals unexpected relationships between COX assembly proteins. Free Radic. Biol. Med. 51, 1589–1600 (2011). | ||
| + | |||
5. Luo D.P., Xu H., Liu Z.L. et al. A detrimental mitochondrial-nuclear interaction causes cytoplasmic male sterility in rice. Nature Genetics, 45(5): 573-577 (2013). | 5. Luo D.P., Xu H., Liu Z.L. et al. A detrimental mitochondrial-nuclear interaction causes cytoplasmic male sterility in rice. Nature Genetics, 45(5): 573-577 (2013). | ||
| + | |||
==Structured Information== | ==Structured Information== | ||
{{JaponicaGene| | {{JaponicaGene| | ||
Revision as of 02:23, 8 June 2014
In CMSWA lines, WA352 accumulates preferentially in the anther tapetum, thereby inhibiting COX11 function in peroxide metabolism and triggering premature tapetal programmed cell death and consequent pollen abortion.
Contents
Annotated Information
Function
Plant cytoplasmic male sterility (CMS) results from incompatibilities between the organellar and nuclear genomes and prevents self pollination, enabling hybrid crop breeding to increase yields.The Wild Abortive CMS (CMSWA) has been exploited in the majority of ‘threeline’ hybrid rice production since the 1970s, but the molecular basis of this trait remains unknown. Plant mitochondrial genomic transformation is currently infeasible, but CMS gene function can be tested by nuclear transformation of candidate gene(s) fused with a mitochondrial transit signal (MTS)[1,2] The suppression of the WA352-interacting gene O. sativa COX11(OsCOX11) can produce male sterility (Fig.1).
COX11 proteins are conserved in eukaryotes and function in the assembly of cytochrome c(Cyt c) oxidase[3] (Fig.2).
In yeast, Saccharomyces cerevisiaeCOX11 (ScCOX11) has a role in hydrogen peroxide degradation[4]. COX11 proteins also function in peroxide metabolism and may act as negative regulators of PCD[5].
Expression
OsCOX11 is constitutively expressed (Fig. 3). A. thaliana AtCOX11 (287 residues), which shares 80% identity with OsCOX11, also interacted with WA352 (Figure 4a). Y2H deletion assays identified two regions (residues 218–292 and 294–352) of WA352 that interact with OsCOX11 (Fig. 4a). Similarly, a 37-residue sequence (184–220) in the highly conserved region of OsCOX11 confers the WA352 binding (Fig. 4b,c). A bimolecular fluorescence complementation (BiFC) assay confirmed the mitochondrial localization of OsCOX11 and its in vivo interaction with WA352 (Fig. 4d and Fig. 5)[5].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
State Key Laboratory for Conservation and Utilization of Subtropical Agro-Bioresources, Key Laboratory of Plant Functional Genomics and Biotechnology of Guangdong Provincial Higher Education Institutions, College of Life Sciences, South China Agricultural University, Guangzhou, China.
College of Forestry, Guangxi University, Nanning, China.
State Key Laboratory of Biocontrol, Guangdong Key Laboratory of Plant Resources, Sun Yat-sen University, Guangzhou, China.
References
1. Wang, Z. et al. Cytoplasmic male sterility of rice with boro II cytoplasm is caused by a cytotoxic peptide and is restored by two related PPR motif genes via distinct modes of mRNA silencing. Plant Cell 18, 676–687 (2006).
2. He, S., Abad, A.R., Gelvin, S.B. & Mackenzie, S.A. A cytoplasmic male sterilityassociated mitochondrial protein causes pollen disruption in transgenic tobacco. Proc. Natl. Acad. Sci. USA 93, 11763–11768 (1996).
3. Banting, G.S. & Glerum, D.M. Mutational analysis of the Saccharomyces cerevisiae cytochrome c oxidase assembly protein Cox11p. Eukaryot. Cell 5, 568–578 (2006).
4. Veniamin, S., Sawatzky, L.G., Banting, G.S. & Glerum, D.M. Characterization of the peroxide sensitivity of COX-deficient yeast strains reveals unexpected relationships between COX assembly proteins. Free Radic. Biol. Med. 51, 1589–1600 (2011).
5. Luo D.P., Xu H., Liu Z.L. et al. A detrimental mitochondrial-nuclear interaction causes cytoplasmic male sterility in rice. Nature Genetics, 45(5): 573-577 (2013).
Structured Information
| Gene Name |
Os03g0718600 |
|---|---|
| Description |
Cytochrome c oxidase assembly protein CtaG/Cox11 family protein |
| Version |
NM_001057624.2 GI:297601593 GeneID:4333922 |
| Length |
2954 bp |
| Definition |
Oryza sativa Japonica Group Os03g0718600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:29862461..29865414 |
| Sequence Coding Region |
29862661..29862762,29862860..29862940,29863453..29863557 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:29862461..29865414 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:29862461..29865414 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>gtgaaggttaaacctggtgaaagtgctcttgcattttatactgctgaaaatcgtagttcagctccaataactggtgtatccacatataacgtagctcctatgaaggctgcaatatatttcaataagatacaatgtttttgctttgaggagcaaacacttcttccaggggagcagattgacatgccggtgttcttctacatcgatcctgagtttgagacagaccccaaaatggaaggggtgaacaatattgtcctttcttacacattctttaaggtgaacgacagttaa</cdnaseq> |
| Protein Sequence |
<aaseq>VKVKPGESALAFYTAENRSSAPITGVSTYNVAPMKAAIYFNKIQ CFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMEGVNNIVLSYTFFKVNDS</aaseq> |
| Gene Sequence |
<dnaseqindica>2653..2754#2475..2555#1858..1962#gtagcgtcgaacaccgtacagcgaatcgcggcggcggaatcacacatcgccgcctctcgcacgcgccgccgcgatgccgccgccgccgccgccttcgttggccaggctccaccaacgcctctccctctcgctcctccggggacgctccccccccgcggcggccgacgccttcctccgccgcgggctcgcctcgtccgcctcctcctcctcttccgccgccgccgccgcggcggtggcggcggcggcggcaggccgggagaagagctcgaggaggacgctagcgtacctgctaggcgtggccgcggcgatggtcggcgcctcctacgccgccgtcccgctctaccgccgcttctgccaggccaccggctatggcggcaccgtccagcgccgcgaggtctggtcttcatttccctaacttgcctctatctttcttgttctcaatcgtaatatgctgaaattaacactgtgctgggacatcgattaagctgtgcttgattttgtggatagcgtctggttccattattggcaggttttagttttacaatctgctgcttggcactgtgatatgctgaaattgatgcgattcatcagctatgtggcctttgtcatgtggagaccgccgttccagttcttatagatgccatggacacgaacgtgttgttgtattgccatgtgtaaattatgagtctagaagattgtaatctattgatagatggcacttcctctcgccgcctctcgcctctcgcactctgcattctattaacaactatgaatatctgtgctggaatttgttaaaatgcccatcaaagggtgatcttacaaatgtgttgggagtggcatgaaatagtttttgattcatttttggtgcttgtatggataactggtctaagtagacattgctgaagcagggttattgttggactctatgaattctgtcaaaaaatagtaataaattttctgggtagtgaatcattcattattcattactggtgcattgaaaaagttctgataaatttggcatctttgtaactacctgattcaagtgagtttgaacctggagtattattccttaacaatgtttggctctctacagagtgtggaggagaagatctcacgacatgctcgagacggaacaacaacttcaaggtgactcttcctatgcccagggtccagttttttcactacttgtcgtttccagttccgaaaggcagtgccatggtggtttttaaaatatactttctatctcttgatagagccttgttgcaatgtgagctcaaactaggcctgtgttgccgatctgttgcctgttgtgtaaattttcctttactgttctcttacatgatcagatggctttttgccaatgtttatggttcagaagtaccttcatttcaaatagtgggatgacatgaaaccacatgtgatgatagatttagatgaagtttaacttggaatagccatacagccttgccagcaattgcatgtgtacagcaaatttgctgtaatcatgggctaatattttggaaaaccattatcttcatgtttatatgattgcaactaattacaagagtttcgggataaatttttaaatgaatttgttgtttcttgtttatccaaataatctcgtgtgctaaaatttagctgtgattcagttttttgatgacactttattttctttgctgttgagactaatgcaattaattttatttgcagagagataattgtccaatttaatgctgacgttgctgatggaatgccgtggaaattcattccaacacagagagaagtaaatgctttgcttaagaaacaatttatagccctttccgcagcatgtttatcctctacctattccatttgtaggtgaaggttaaacctggtgaaagtgctcttgcattttatactgctgaaaatcgtagttcagctccaataactggtgtatccacatataacgtagctcctatgaaggtatgtaattcagcacaacttttacacccttaaactgctgccatgtcctggaaagaaagatttgtgagagatgcagaagtgtctctggattcacaaagctactgtaggcctttaactcttaatcctttgttaattttgttagcctaaattagtggaaatatgttggatgtaatcctttaacttttaatcctatattcttttttgttaaatatgttaagttaaatagccccaactctcaagcatgatttctaggaagaaaatttttgaaaccattagccatgattagacttcctcaactgataagagtttgaaaactgtgatcagaaaattgtagaaaacataacctctgctgtgatattcttagtcaaggagtgactcaggtgacttcacaatatcatcctatttatgttgctaactcaaattatgctgaggtgtacagctagggcatttaagctaacaggaggcagactcctaatgttttgagtttacaactcttttctttcatcctgtaggctgcaatatatttcaataagatacaatgtttttgctttgaggagcaaacacttcttccaggggagcagattgacatgccggtaaattcaacttgcattcgatgaaatgcatggctagttagttatctggtgtttgtctacacttattccaactttgtatgtgaacttttttcttcaggtgttcttctacatcgatcctgagtttgagacagaccccaaaatggaaggggtgaacaatattgtcctttcttacacattctttaaggtgaacgacagttaattgtatcggtaccgtaaagtaagtggtaacattagttctatttaaacaccttgccaacgagtaacacaaaaattcctttcatgtaacacaagttagggttttgtttagtgtgtattaattgacatgtgtttcttggaaattttgcaaataaatatgtaagaattgttcacagaacaatcgaaatggtgcatcttgatttg</dnaseqindica> |
| External Link(s) |