Difference between revisions of "OsCEBiP"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 1: Line 1:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
   Chitin (a polymer of N-acetyl-D-glucosamine) is a major component of fungal cell walls that triggers various defense responses in both animals and plants. The defense responses triggered by chitin perception in rice are similar to those in other plant species, including reactive oxygen species (ROS) generation, pathogenesis-related (PR) gene expression and biosynthesis of phytoalexins. The chitin elicitor binding protein (OsCEBiP) is a plasma membrane glycoprotein that contains two LysM domains but lacks an intracellular kinase.  
+
   Chitin (a polymer of N-acetyl-D-glucosamine) is a major component of fungal cell walls that triggers various defense responses in both animals and plants.  
 +
The defense responses triggered by chitin perception in rice are similar to those in other plant species, including reactive oxygen species (ROS)
 +
generation, pathogenesis-related (PR) gene expression and biosynthesis of phytoalexins. The chitin elicitor binding protein (OsCEBiP) is a plasma membrane glycoprotein that contains two LysM domains but lacks an intracellular kinase.  
 
   It has to work with Chitin elicitor receptor kinase 1 (OsCERK1 also known as LysM-RLK1).OsCERK1 and OsCEBiP form hetero- and homo-dimers in Y2H assays. OsCEBiP and OsCERK1 are present in a receptor complex immuno-precipitated from rice cells treated with chitin indicating that these proteins interact in vivo upon ligand recognition. In cultured rice cells, the recognition of chitin elicitor induces a series of defense responses including the activation of MAPKs, ROS production, defense gene expression,  phytoalexin production and the accumulation of phosphatidic acid (PA).
 
   It has to work with Chitin elicitor receptor kinase 1 (OsCERK1 also known as LysM-RLK1).OsCERK1 and OsCEBiP form hetero- and homo-dimers in Y2H assays. OsCEBiP and OsCERK1 are present in a receptor complex immuno-precipitated from rice cells treated with chitin indicating that these proteins interact in vivo upon ligand recognition. In cultured rice cells, the recognition of chitin elicitor induces a series of defense responses including the activation of MAPKs, ROS production, defense gene expression,  phytoalexin production and the accumulation of phosphatidic acid (PA).
 
   Recent research finds that OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus in. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM.
 
   Recent research finds that OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus in. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM.

Revision as of 03:02, 8 June 2014

Annotated Information

Function

 Chitin (a polymer of N-acetyl-D-glucosamine) is a major component of fungal cell walls that triggers various defense responses in both animals and plants. 
The defense responses triggered by chitin perception in rice are similar to those in other plant species, including reactive oxygen species (ROS)  

generation, pathogenesis-related (PR) gene expression and biosynthesis of phytoalexins. The chitin elicitor binding protein (OsCEBiP) is a plasma membrane glycoprotein that contains two LysM domains but lacks an intracellular kinase.

 It has to work with Chitin elicitor receptor kinase 1 (OsCERK1 also known as LysM-RLK1).OsCERK1 and OsCEBiP form hetero- and homo-dimers in Y2H assays. OsCEBiP and OsCERK1 are present in a receptor complex immuno-precipitated from rice cells treated with chitin indicating that these proteins interact in vivo upon ligand recognition. In cultured rice cells, the recognition of chitin elicitor induces a series of defense responses including the activation of MAPKs, ROS production, defense gene expression,  phytoalexin production and the accumulation of phosphatidic acid (PA).
 Recent research finds that OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus in. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM.

So, the early component of chitin-induced rice innate immunity is OsCEBiP/OsCERK1-OsRacGEF1-OSRac1.

Localization

OsCEBiP is localized at the plasma membrane of rice, together with OsCERK1.


Evolution

OsCEBiP is a homologous gene to CEBiP, which is discovered in Arabidopsis.


Labs working on this gene

  • Department of Life Sciences, Faculty of Agriculture, Meiji University, 1-1-1 Higashi-Mita, Tama-ku, Kawasaki, Kanagawa 214-8571, Japan
  • Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
  • Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan

References

  • Takeo Shimizu, Takuto Nakano, Daisuke Takamizawa, et al.Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice.

The Plant Journal, 2010, 64(2): 204-214.

Structured information

Gene Name

OsCEBiP

Description

LysM receptor-like kinase

Version

AB510402.1 GI:299507947

Length

1818 bp

Definition

Oryza sativa Japonica Group LysM RLK mRNA for LysM receptor-like kinase, complete cds.

Source

Oryza sativa Japonica Group

Chromosome

Chromosome 9

Location

{{{AP}}}

Sequence Coding Region

{{{CDS}}}

Expression

GEO Profiles:OsCEBiP

Genome Context

{{{GCID}}}

Gene Structure

{{{GSID}}}

Coding Sequence

<cdnaseq>ATGTTCTCTCTCCCCGCCCTCCTCATCGGCGCCTGTGCCTTCGCGGCGGCGGCGGTTGCGGCGTCCGGCG ACGGTTGCCGCGCCGGCTGCTCGCTGGCCATCGCCGCCTACTACTTCTCCGAGGGTTCAAACCTCACCTT CATCGCCACCATCTTCGCCATCGGCGGCGGCGGCTACCAAGCGCTGCTCCCCTACAACCCGGCCATCACC AACCCGGACTACGTCGTCACCGGCGACCGCGTGCTCGTTCCCTTCCCCTGCTCCTGCCTCGGGCTCCCCG CCGCGCCCGCCTCCACCTTCCTCGCAGGCGCCATCCCCTACCCGCTCCCCCTCCCCCGCGGCGGCGGCGA CACCTACGACGCCGTCGCCGCCAACTACGCCGACCTCACCACCGCCGCGTGGCTGGAGGCCACCAACGCG TACCCGCCGGGGAGGATCCCCGGCGGCGATGGGAGGGTCAACGTCACCATCAACTGCTCATGCGGCGACG AGAGGGTCTCGCCGCGGTACGGGCTGTTCCTCACCTACCCGCTCTGGGACGGGGAGACGCTCGAATCGGT GGCCGCGCAGTACGGGTTCTCGTCGCCGGCGGAGATGGAGCTGATCAGGAGGTACAACCCCGGGATGGGA GGGGTCTCCGGGAAGGGGATTGTGTTCATCCCGGTGAAAGATCCAAATGGAAGTTACCACCCTCTGAAAT CAGGTGGAATGGGGAATAGCCTTTCTGGAGGAGCGATAGCAGGAATTGTGATAGCTTGCATTGCTATTTT CATTGTGGCCATATGGTTGATTATCATGTTCTATAGGTGGCAAAAGTTCAGGAAGGCCACATCGCGTCCA TCTCCAGAAGAAACCAGCCACCTTGATGATGCTTCCCAAGCTGAAGGCATTAAGGTTGAGAGATCCATAG AATTCTCATATGAAGAGATTTTTAATGCAACACAGGGATTTTCTATGGAACATAAAATTGGGCAAGGTGG TTTTGGTTCAGTGTATTATGCTGAGCTTAGAGGCGAGAAAACTGCCATAAAGAAAATGGGCATGCAAGCA ACTCAAGAATTCCTTGCTGAACTGAAGGTCTTGACACATGTTCACCACTTGAATCTGGTGCGCCTGATTG GTTATTGTGTTGAGAATTGCTTATTTCTTGTCTATGAATTTATTGACAATGGAAACCTAAGTCAGCATCT CCAAAGGACTGGTTATGCGCCTCTCTCATGGGCTACCAGAGTGCAAATTGCCCTAGACTCAGCACGTGGT CTTGAGTACCTTCATGAACATGTTGTTCCAGTATATGTTCATAGGGATATCAAGTCTGCAAATATCCTAT TAGACAAGGACTTCCGGGCAAAGATTGCTGATTTTGGACTAGCAAAACTTACAGAAGTTGGAAGTATGTC GCAGTCACTGTCAACACGAGTTGCTGGTACATTTGGTTACATGCCTCCAGAAGCTCGATATGGTGAGGTT TCTCCTAAGGTGGATGTCTATGCTTTTGGTGTCGTCCTTTATGAACTTCTTTCAGCCAAACAAGCTATTG TGAGATCAAGTGAATCTGTTAGCGAATCAAAAGGACTGGTTTTCCTGTTTGAGGAGGCCCTCAGCGCTCC AAACCCCACGGAAGCTCTTGACGAACTGATTGATCCGAGCCTGCAAGGGGACTACCCCGTCGACTCGGCT CTCAAGATTGCGTCCCTTGCAAAGTCCTGCACGCATGAGGAGCCCGGGATGAGGCCTACCATGAGATCCG TCGTCGTTGCCCTGATGGCGCTCACAGCCAACACCGATCTTCGCGACATGGACTACCACCCTTTCTGA</cdnaseq>

Protein Sequence

<aaseq>MFSLPALLIGACAFAAAAVAASGDGCRAGCSLAIAAYYFSEGSNLTFIATIFAIGGGGYQALLPYNPAITNPDYVVTGDRVLVPFPCSCLGLPAAPASTFLA GAIPYPLPLPRGGGDTYDAVAANYADLTTAAWLEATNAYPPGRIPGGDGRVNVTINCSCGDERVSPRYGLFLTYPLWDGETLESVAAQYGFSSPAEMELIRRYNPGMGGVSGKGIV FIPVKDPNGSYHPLKSGGMGNSLSGGAIAGIVIACIAIFIVAIWLIIMFYRWQKFRKATSRPSPEETSHLDDASQAEGIKVERSIEFSYEEIFNATQGFSMEHKIGQGGFGSVYYA ELRGEKTAIKKMGMQATQEFLAELKVLTHVHHLNLVRLIGYCVENCLFLVYEFIDNGNLSQHLQRTGYAPLSWATRVQIALDSARGLEYLHEHVVPVYVHRDIKSANILLDKDFRA KIADFGLAKLTEVGSMSQSLSTRVAGTFGYMPPEARYGEVSPKVDVYAFGVVLYELLSAKQAIVRSSESVSESKGLVFLFEEALSAPNPTEALDELIDPSLQGDYPVDSALKIASL AKSCTHEEPGMRPTMRSVVVALMALTANTDLRDMDYHPF</aaseq>

Gene Sequence

{{{DNA}}}

External Link(s)

NCBI Gene:OsCEBiP, {{{Link}}}