Difference between revisions of "Os05g0108800"
(→Annotated Information) |
|||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
| + | The sequence of ''Os05g0108800''is same to ''Cb5'' in tobacco, which encodes cytochrome b5. | ||
===Function=== | ===Function=== | ||
| − | + | cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi[1,2]. The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds[3,4]. | |
| + | A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion.[5] | ||
===Expression=== | ===Expression=== | ||
| − | + | In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering). | |
===Evolution=== | ===Evolution=== | ||
| − | + | This cDNA encodes a protein of 139 residues which exhibits a high degree of homology to other cytochrome b5s, the message for which is expressed predominantly in developing seeds and in pigmented flower tissue. | |
| − | |||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Revision as of 05:40, 8 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
The sequence of Os05g0108800is same to Cb5 in tobacco, which encodes cytochrome b5.
Function
cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi[1,2]. The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds[3,4]. A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion.[5]
Expression
In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering).
Evolution
This cDNA encodes a protein of 139 residues which exhibits a high degree of homology to other cytochrome b5s, the message for which is expressed predominantly in developing seeds and in pigmented flower tissue. You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os05g0108800 |
|---|---|
| Description |
Cytochrome b5 |
| Version |
NM_001060969.1 GI:115461668 GeneID:4337583 |
| Length |
1812 bp |
| Definition |
Oryza sativa Japonica Group Os05g0108800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:470434..472245 |
| Sequence Coding Region |
470569..470658,471609..471675,471795..472051 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttag</cdnaseq> |
| Protein Sequence |
<aaseq>MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGG DDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQ DKTPEFIIKILQFLVPLAILGLAVAIRIYTKSESA</aaseq> |
| Gene Sequence |
<dnaseqindica>136..225#1176..1242#1362..1618#atccccacgagacgagaaacctagcaaaaatctcgtctttcgccgcgctctccctcctctgattcctgctgttcttgatcttggatctcaattcccaaccaagaacacacagacagagaaaggaaggagaagaagatgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtctcatcttttgtttttcttttcttttcacgcttttacttacttgtactattcgatttcatgtttcgattcgtttcgttggttcttggttccctatcctccaacaacgtcctgagacctcgatctggtcggagtccacgaccagatcttggccgcggcgcagatctggccctccagccgccggcgtggggaccttgccagatctggtcttctccgacggtggccaacttctcttgtcccttggttgcagccaccaaacctcttcctcccctcctcgatccaaccttggtcttgttcatcgactggccactaaaccccaaataagcgagatagaatttggattcgtttcgttggttattgtttctctgatgctgtgatggtggctagatcatggcagatctgcccagtaaagtcgaattttgtttgattccaccgcacctcctgaggaatcggtccaatcctgtgaattcttctcttctttcctgctgattggattgtctacatgggctttacctggaaacaggggtgagtgctagcagattcaaacatcatggactgactgctcctaaacaagttccatatgaaaacctgttctacatgctttttttcttttactcttcactcgttgtcagtcaaacactgcaaaatttgtccctgcgcctattctgcaagagcttcttgttagtacaactgaagaatcaatcctctgttccaacttggcatctggacagaataatgaatgtttcataggaaaggctcagctcaactaagtaaatcatgttgattggccttaaaacacacttcattaagagtctgttttttttatattggacatgataagaataatatggctgttttttattattaatgttttttcttggtaacagtgcttctattgatgaacctaccctgtttacctgatctcaccagtgttctgcaatactatccaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggtacgccttctcaattctcatgttctggccttctgagtagtgaccactactgatgaattaactgagtttgcaatggatggtttagcttacactttgaaatatacatggaccttctgcaggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttagtgctgttctcttagtgttataagagtggaaggtaccgaataagttagcaagagttttgtgtgattcataccagtgtaacatgtcatgaattcgtcgaatgttctgaagatgctgtgggttttgtggtcctgggatgtccacttcggtaaagatcgataagattcaaagtactcgttaatcgttatacattctga</dnaseqindica> |
| External Link(s) |
