Difference between revisions of "Os02g0100100"

From RiceWiki
Jump to: navigation, search
Line 5: Line 5:
 
Protein disulfide isomerase or PDI is an enzyme in the endoplasmic reticulum in eukaryotes that catalyzes the formation and breakage of disulfide bonds between cysteine residues within proteins as they fold.[1][2][3]
 
Protein disulfide isomerase or PDI is an enzyme in the endoplasmic reticulum in eukaryotes that catalyzes the formation and breakage of disulfide bonds between cysteine residues within proteins as they fold.[1][2][3]
 
Please input function information here.
 
Please input function information here.
==1.1 Protein folding==
+
===1.1 Protein folding===
 
  PDI contains four thioredoxin-like domains, two of which retain the canonical CXXC motif. The reduced (that is, dithiol) form of PDI is able to catalyse a reduction of mispaired thiol residues of a particular substrate, acting as an isomerase.[4] Therefore, PDI is capable of catalyzing the posttranslational modification disulfide exchange. Such exchange reactions can occur intramolecularly, leading to the rearrangement of disulfide bonds in a single protein.[5]
 
  PDI contains four thioredoxin-like domains, two of which retain the canonical CXXC motif. The reduced (that is, dithiol) form of PDI is able to catalyse a reduction of mispaired thiol residues of a particular substrate, acting as an isomerase.[4] Therefore, PDI is capable of catalyzing the posttranslational modification disulfide exchange. Such exchange reactions can occur intramolecularly, leading to the rearrangement of disulfide bonds in a single protein.[5]
  
==1.2Redox signaling==  
+
===1.2Redox signaling===  
 
In the chloroplasts of the unicellular algae Chlamydomonas reinhardtii the PDI RB60 serves as a redox sensor component of an mRNA-binding protein complex implicated in the photo-regulation of the translation of psbA, the RNA encoding for the photosystem II core protein D1. PDI has also been suggested to play a role in the formation of regulatory disulfide bonds in chloroplasts.[6]
 
In the chloroplasts of the unicellular algae Chlamydomonas reinhardtii the PDI RB60 serves as a redox sensor component of an mRNA-binding protein complex implicated in the photo-regulation of the translation of psbA, the RNA encoding for the photosystem II core protein D1. PDI has also been suggested to play a role in the formation of regulatory disulfide bonds in chloroplasts.[6]
  
==1.3 Other functions==
+
===1.3 Other functions===
 
PDI helps load antigenic peptides into MHC class I molecules. These molecules (MHC I) are related to the peptide presentation by antigen-presenting cells in the immune response.
 
PDI helps load antigenic peptides into MHC class I molecules. These molecules (MHC I) are related to the peptide presentation by antigen-presenting cells in the immune response.
  

Revision as of 05:54, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Protein disulfide isomerase or PDI is an enzyme in the endoplasmic reticulum in eukaryotes that catalyzes the formation and breakage of disulfide bonds between cysteine residues within proteins as they fold.[1][2][3] Please input function information here.

1.1 Protein folding

PDI contains four thioredoxin-like domains, two of which retain the canonical CXXC motif. The reduced (that is, dithiol) form of PDI is able to catalyse a reduction of mispaired thiol residues of a particular substrate, acting as an isomerase.[4] Therefore, PDI is capable of catalyzing the posttranslational modification disulfide exchange. Such exchange reactions can occur intramolecularly, leading to the rearrangement of disulfide bonds in a single protein.[5]

1.2Redox signaling

In the chloroplasts of the unicellular algae Chlamydomonas reinhardtii the PDI RB60 serves as a redox sensor component of an mRNA-binding protein complex implicated in the photo-regulation of the translation of psbA, the RNA encoding for the photosystem II core protein D1. PDI has also been suggested to play a role in the formation of regulatory disulfide bonds in chloroplasts.[6]

1.3 Other functions

PDI helps load antigenic peptides into MHC class I molecules. These molecules (MHC I) are related to the peptide presentation by antigen-presenting cells in the immune response.

PDI has been found to be involved in the breaking of bonds on the HIV gp120 protein during HIV infection of CD4 positive cells, and is required for HIV infection of lymphocytes and monocytes.[7]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0100100

Description

Protein disulphide isomerase family protein

Version

NM_001052114.1 GI:115443598 GeneID:4327971

Length

4744 bp

Definition

Oryza sativa Japonica Group Os02g0100100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:3634..8377

Sequence Coding Region

3864..4049,4861..4917,5514..5648,5728..5808,5884..5952
,6419..6493,6619..6705,6873..6953,7045..7163
,7262..7430,7538..7667,7753..8255

Expression

GEO Profiles:Os02g0100100

Genome Context

<gbrowseImage1> name=NC_008395:3634..8377 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:3634..8377 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcgctcccgatctctcctcctcgtcgccctcgccacccttcttctccacgcctccgcctccgcctccgacgacgacctcgactacctcatcgacaacgccgacgacatccccgccaacgaccccgacggctggctccaggagggctcccccgacgacgacgacgacgacgacctcttccaccatggccaggcccaggaccatcccatagatgagacccacgtcttcctcctctccgccgccaacttctccgacttcctcgcctcccaccgccatgtcatggtcgagttctacgccccctggtgcgcccattgccaggcgctcgccccagactacgccgccgccgccgccgacctctcccctcttgcccatcaagtcgccctcgccaaggtcgacgccaccgaggacactgatctcgcccagaagtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgttcccaaggactacaacggcgcaagaaccaaggaagccatcgtgtcgtgggtcaacaagaagctagctcccggggtgcaaaacatcaccaccgtcgacgaggcggagaagatactcaccggggaggacaaggccattcttgccgtcctcgactccctatcgggtgctcacagtgatgagattgctgctgcttcgaggctggaagatgctatcaacttttaccagacttccaatcctgatgttgccaagctttttcaccttgacccagcggccaagcgcccgtccttagtcctgctcaagaaacaagaggaggagaagttgaccttctatgatgggccattcaaagcatctgcaattgccgattttgtatctgcaaacaagcttccgttggtcaacaccctcacacaggaaactgctccttccatttttgacaatccaatcaagaagcagattttactatttgttgttgcaaacgaatcgtcgaaatttctgcccatctttaaggaagcatcaaaatcattcaaggggaagcttttgtttgtctttgtggagcgtgacaatgaggaagtaggtgaaccagttgccaactactttggtattactggacaagagaccacagttcttgcttacactgggaatgaagatgctaggaattttttccttgatggtgaaatatcggtagagaatattaagagatttgctgaggatttcttagaggaaaagctcacaccgttctacaagtctgaacctgtacctgaatctaatgaaggagatgtcaaaattgttgttggaaaaaacctagatcagattgttttggatgaatcaaaagatgcccttttggagatatatgcaccatggtgtgggcattgtcaggaactggagcctacctacaacaagctaggaaagcatctccgtggcattgactcccttgtaatagctaaaatggatggcactgccaatgagcatccacgtgcaaagcctgatggattcccaacgatcctcttttatccagcaggaaagaaaagttttgagcctattacttttgagggggaccgtacggtggtggagatgtacaagtttatcaagaagcacgctagcatccctttcaaactgaagcggccggattcgtcagcaacgaaaacagagaaggatcagagcacagcttcaactaatttgaggggggagaggagttccggtacaaatttcaaggatgagttgtag</cdnaseq>

Protein Sequence

<aaseq>MRSRSLLLVALATLLLHASASASDDDLDYLIDNADDIPANDPDG WLQEGSPDDDDDDDLFHHGQAQDHPIDETHVFLLSAANFSDFLASHRHVMVEFYAPWC AHCQALAPDYAAAAADLSPLAHQVALAKVDATEDTDLAQKYDVQGFPTILFFIDGVPK DYNGARTKEAIVSWVNKKLAPGVQNITTVDEAEKILTGEDKAILAVLDSLSGAHSDEI AAASRLEDAINFYQTSNPDVAKLFHLDPAAKRPSLVLLKKQEEEKLTFYDGPFKASAI ADFVSANKLPLVNTLTQETAPSIFDNPIKKQILLFVVANESSKFLPIFKEASKSFKGK LLFVFVERDNEEVGEPVANYFGITGQETTVLAYTGNEDARNFFLDGEISVENIKRFAE DFLEEKLTPFYKSEPVPESNEGDVKIVVGKNLDQIVLDESKDALLEIYAPWCGHCQEL EPTYNKLGKHLRGIDSLVIAKMDGTANEHPRAKPDGFPTILFYPAGKKSFEPITFEGD RTVVEMYKFIKKHASIPFKLKRPDSSATKTEKDQSTASTNLRGERSSGTNFKDEL</aaseq>

Gene Sequence

<dnaseqindica>4329..4514#3461..3517#2730..2864#2570..2650#2426..2494#1885..1959#1673..1759#1425..1505#1215..1333#948..1116#711..840#123..625#gctcttatcgaaaattaaaaaaagagagagaaataaaaggggatcgatccgctcttgtagttgtagagcgttccattccacttccacagcagtggactcagtgagcaacggaggaagcaacgatgcgctcccgatctctcctcctcgtcgccctcgccacccttcttctccacgcctccgcctccgcctccgacgacgacctcgactacctcatcgacaacgccgacgacatccccgccaacgaccccgacggctggctccaggagggctcccccgacgacgacgacgacgacgacctcttccaccatggccaggcccaggaccatcccatagatgagacccacgtcttcctcctctccgccgccaacttctccgacttcctcgcctcccaccgccatgtcatggtcgagttctacgccccctggtgcgcccattgccaggcgctcgccccagactacgccgccgccgccgccgacctctcccctcttgcccatcaagtcgccctcgccaaggtcgacgccaccgaggacactgatctcgcccagaagtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgttcccaaggactacaacggcgcaagaaccaagtgcgtgtcccccctccccccagatcccatctcatctcgtctcttggcttcaatttctttgacttgtctcttgccttggctccagggaagccatcgtgtcgtgggtcaacaagaagctagctcccggggtgcaaaacatcaccaccgtcgacgaggcggagaagatactcaccggggaggacaaggccattcttgccgtcctcgactccctatcggtaccttctcttctcttctactcaagtcaaccccgatgctctttctaaattcttactgcacacacactattattattaatcttcttttcaaaccctactacttacagggtgctcacagtgatgagattgctgctgcttcgaggctggaagatgctatcaacttttaccagacttccaatcctgatgttgccaagctttttcaccttgacccagcggccaagcgcccgtccttagtcctgctcaagaaacaagaggaggagaagttgaccttctatggtacccttctctctaagtcactttaagcatcaatcccctcatttctattttccatgcggggcttggttgttggataatatactccacctatcatgcagatgggccattcaaagcatctgcaattgccgattttgtatctgcaaacaagcttccgttggtcaacaccctcacacaggaaactgctccttccatttttgacaatccaatcaagaagcaggcatgtctaattgatattgcttctgtacatttctcacttttttggtccatttatacattactgggctgctaacttttatttttcaaaccagattttactatttgttgttgcaaacgaatcgtcgaaatttctgcccatctttaaggaagcatcaaaatcattcaaggggaaggtagtttttttttcttttgatccgtcaagttatcagcaaacttacttccgttgcttcacatgctttactcaaatttggtgctatgcaacaccacttatcactttcccattctatttatttactgatgtgttcgtttaccactgatgaggtgtgtggccaaaatgcagcttttgtttgtctttgtggagcgtgacaatgaggaagtaggtgaaccagttgccaactactttggtattactggacaagagaccacagtaatgacttgtgttctttgttacctttatctgtactgttgtttcttgcatcgaaattggatgctgcaatttagcctccatttaatgtgtttgtgttatttttttgtttgtccctatgactgtaggttcttgcttacactgggaatgaagatgctaggaattttttccttgatggtgaaatatcggtagagaatattaaggtaattgttgacacaggcccatgcacagtgccttattagatgtaaaaatagcataggagtgtgctcaagtagttcgaacaaattgttcattatgttaccaagtttcaagctagcatgtaatcaccaatcatttgagtttttttggcaaatgcattttctatttgtactgtattaatttaacctgagaatcttgcatgtatttgtggtttgtgcattatcaattaatattgcattttgtagtgaacaaatgcaatgtgcatctttttgcaatttatgcaccatgccgtttggtgtagaagttgtccttttaactagggtacttattacttttcttggacactgttgatattgagttctgccactgctagtgaggaaggagtcgactatcattctccaagaatttttcttattccttgaaggcttggttattggacacctttattgtttttatcctttttacatgcagagatttgctgaggatttcttagaggaaaagctcacaccgttctacaagtctgaacctgtacctgaatctgtgagtctataattatatgatgggttctttctccacttattgtaccataatgagacattctgtgttcccatacagaatgaaggagatgtcaaaattgttgttggaaaaaacctagatcagattgttttggatgaatcaaaagatgcccttttggaggtatgttcttcctggaaggtaaattatgagaaaaatggtatttatatgtggtccataatcgttgttgctgttgttgcagatatatgcaccatggtgtgggcattgtcaggaactggagcctacctacaacaagctaggaaagcatctccgtggcattgactcccttgtaatagctaaaatggatggcactgccaatgagcatccacgtgcaaaggtctgttctgcttcctgttggttttggcagtttcacttcacttttctttgaactggatattagaaagtaaaatttggaggcacgaaatgaagagtttaatttcctgtgctattgtggccaaaagatcttgtgcatgtatgatatgaaacaccgctagttatgaaaaatgtgagggttgctcaactgctttgttattcgaaatcgcacttttgcacactgcacaaaaaaggtacatatccatccatcatctaatactacatacatttcaatgttgatttacttctcatccatgtatatgtattcacgcactacgatctcacgagtatgcatcagtggtacagtattttgaggcagtagtgaccactgtagcatgtgaaatttgacttgtagttggaacaattcatttcccctccaatctccatgcaatctgaaccttcaagattggctcatagtttgctagtactattcttttatgtgattatcttccttaaattttcaatgcatgcatgcatgcatgcttagtcttgtttatttttccattttattatgttgtaaactttccatattacagaattaacacttgcttcttgtcacagcctgatggattcccaacgatcctcttttatccagcaggaaagaaaagttttgagcctgtaagtgcccaaatatgtgtcatgtcttattgaggggtgcatttgttactgtatgtaatctgtctctcagtaggtttgttacctctctcttcggtagaattgcctagatttcttataatctgctaaaaccgaaatatatctgtctctctctctctgtagaaatcttgaatcacctctctactatatgttaccgcactattcaaactgcatgcgtgtccttggtttcttgctaaaaaaaaatccaacctgcacggctgcacctatggcattgaagtcattctgcgctataacatttgttgaggtctttcccttaaaacaacatttgttgaggtcggaattcaagatacgttaggcgtatatctgacaagttatgtttatgagattttgagatcctgaaagggtccgtatataacagtatttaccagaagtctaatttagggagtgtttagatctaggggtgtaaagttttggcgtgtcacatcgggtatatagggtgtcgcatagggtgtttgcgcactaataaaaaaactaattacagaatccgtcagtaaaccacgagatgaatttattaagcctaattaatctatcattagtaaatgtttactgtagcaccacattgtcaaatcatggggcaattaggcttaaaaatccatctcgcaaattagtcacaatctatgcaattagttatttttttagtctatatttaatattttatgtagttgttcaaacgttcgatgtgatagggtgtaaaatttttgtgtgggaaccaaacagggccttatttaatttggctgtgcgttattgtgtgcagattacttttgagggggaccgtacggtggtggagatgtacaagtttatcaagaagcacgctagcatccctttcaaactgaagcggccggattcgtcagcaacgaaaacagagaaggatcagagcacagcttcaactaatttgaggggggagaggagttccggtacaaatttcaaggatgagttgtagtcttgtagagcggcattggtgcaacctttgaacaaggcaacgacgctctctagaaaaggctgtttctttttatgtatgcgagggcctgaggggcagcagaaaggaatccaaagttggtttctactttctatagagagtattccggtaaggagttagcttggacgatgtgcatgttgagatgaacgaattgaatcgaatcgaatggaataaaagcaaacgaaacggcttcg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0100100, RefSeq:Os02g0100100