Difference between revisions of "Os05g0108800"
(→Structured Information) |
(→Annotated Information) |
||
| Line 1: | Line 1: | ||
''Os05g0108800'' encodes the protein Cytochrome b5. | ''Os05g0108800'' encodes the protein Cytochrome b5. | ||
==Annotated Information== | ==Annotated Information== | ||
| − | + | By blast, we can find the sequence of ''Os05g0108800''is same to ''''Cyto b5'''' in tobacco(query coverage is 100%), which encodes cytochrome b5, a rather conserved and essential protein. | |
===Function=== | ===Function=== | ||
| − | cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi.<ref name="ref1"/><ref name="ref2"/> The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds.<ref name="ref3"/><ref name="ref4"/>A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion.<ref name="ref5"/><br /> | + | Cytochromes b5 are ubiquitous electron transport hemoproteins found in animals, plants, fungi and purple phototrophic bacteria. The microsomal and mitochondrial variants are membrane-bound, while bacterial and those from erythrocytes and other animal tissues are water-soluble. The family of cytochrome b5-like proteins includes (besides cytochrome b5 itself) hemoprotein domains covalently associated with other redox domains in flavocytochrome cytochrome b2 (L-lactate dehydrogenase; EC 1.1.2.3), sulfite oxidase (EC 1.8.3.1), plant and fungal nitrate reductases (EC 1.7.1.1, EC 1.7.1.2, EC 1.7.1.3), and plant and fungal cytochrome b5/acyl lipid desaturase fusion proteins. Cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi.<ref name="ref1"/><ref name="ref2"/> The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds.<ref name="ref3"/><ref name="ref4"/>A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion.<ref name="ref5"/><br /> |
===Expression=== | ===Expression=== | ||
Revision as of 07:31, 8 June 2014
Os05g0108800 encodes the protein Cytochrome b5.
Contents
Annotated Information
By blast, we can find the sequence of Os05g0108800is same to 'Cyto b5' in tobacco(query coverage is 100%), which encodes cytochrome b5, a rather conserved and essential protein.
Function
Cytochromes b5 are ubiquitous electron transport hemoproteins found in animals, plants, fungi and purple phototrophic bacteria. The microsomal and mitochondrial variants are membrane-bound, while bacterial and those from erythrocytes and other animal tissues are water-soluble. The family of cytochrome b5-like proteins includes (besides cytochrome b5 itself) hemoprotein domains covalently associated with other redox domains in flavocytochrome cytochrome b2 (L-lactate dehydrogenase; EC 1.1.2.3), sulfite oxidase (EC 1.8.3.1), plant and fungal nitrate reductases (EC 1.7.1.1, EC 1.7.1.2, EC 1.7.1.3), and plant and fungal cytochrome b5/acyl lipid desaturase fusion proteins. Cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi.[1][2] The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds.[3][4]A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion.[5]
Expression
In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering).[5]
Evolution
This cDNA encodes a protein of 139 residues which exhibits a high degree of homology to other cytochrome b5s, the message for which is expressed predominantly in developing seeds and in pigmented flower tissue. You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
- ↑ Ozols J: Structure of cytochromeb 5 and its topology in the microsomal membrane. Biochim Biophys Acta 997 121–130 (1989).
- ↑ Rich PR, Bendall DS: Cytochrome components of plant microsomes. Eur J Biochem 55: 333–341 (1975).
- ↑ Kearns EV, Hugly S, Somerville CR: The role of cytochromeb 5 in Δ12 desaturation of oleic acid by microsomes of safflower (Carthamus tinctorius L.). Arch Biochem Biophys 284: 431–436 (1991).
- ↑ Smith MA, Cross AR, Jones OTG, Griffiths WT, Stymne S, Stobart AK: Electron transport components of the 1-acyl-2-oleoyl-sn-glycero-3-phosphocholine 537–1 (Δ12-desaturase) in microsomal preparations from developing safflower (Carthamus tinctorius L.) cotyledons. Biochem J 272: 23–29 (1990).
- ↑ 5.0 5.1 Mark A. Smith, A. Keith Stobart, Peter R. Shewry, Johnathan A. Napier:Tobacco cytochromeb 5: cDNA isolation, expression analysis andin vitro protein targeting. Plant Molecular Biology: 527-537(1994)
Structured Information
| Gene Name |
Os05g0108800 |
|---|---|
| Description |
Cytochrome b5 |
| Version |
NM_001060969.1 GI:115461668 GeneID:4337583 |
| Length |
1812 bp |
| Definition |
Oryza sativa Japonica Group Os05g0108800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:470434..472245 |
| Sequence Coding Region |
470569..470658,471609..471675,471795..472051 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttag</cdnaseq> |
| Protein Sequence |
<aaseq>MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGG DDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQ DKTPEFIIKILQFLVPLAILGLAVAIRIYTKSESA</aaseq> |
| Gene Sequence |
<dnaseqindica>136..225#1176..1242#1362..1618#atccccacgagacgagaaacctagcaaaaatctcgtctttcgccgcgctctccctcctctgattcctgctgttcttgatcttggatctcaattcccaaccaagaacacacagacagagaaaggaaggagaagaagatgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtctcatcttttgtttttcttttcttttcacgcttttacttacttgtactattcgatttcatgtttcgattcgtttcgttggttcttggttccctatcctccaacaacgtcctgagacctcgatctggtcggagtccacgaccagatcttggccgcggcgcagatctggccctccagccgccggcgtggggaccttgccagatctggtcttctccgacggtggccaacttctcttgtcccttggttgcagccaccaaacctcttcctcccctcctcgatccaaccttggtcttgttcatcgactggccactaaaccccaaataagcgagatagaatttggattcgtttcgttggttattgtttctctgatgctgtgatggtggctagatcatggcagatctgcccagtaaagtcgaattttgtttgattccaccgcacctcctgaggaatcggtccaatcctgtgaattcttctcttctttcctgctgattggattgtctacatgggctttacctggaaacaggggtgagtgctagcagattcaaacatcatggactgactgctcctaaacaagttccatatgaaaacctgttctacatgctttttttcttttactcttcactcgttgtcagtcaaacactgcaaaatttgtccctgcgcctattctgcaagagcttcttgttagtacaactgaagaatcaatcctctgttccaacttggcatctggacagaataatgaatgtttcataggaaaggctcagctcaactaagtaaatcatgttgattggccttaaaacacacttcattaagagtctgttttttttatattggacatgataagaataatatggctgttttttattattaatgttttttcttggtaacagtgcttctattgatgaacctaccctgtttacctgatctcaccagtgttctgcaatactatccaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggtacgccttctcaattctcatgttctggccttctgagtagtgaccactactgatgaattaactgagtttgcaatggatggtttagcttacactttgaaatatacatggaccttctgcaggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttagtgctgttctcttagtgttataagagtggaaggtaccgaataagttagcaagagttttgtgtgattcataccagtgtaacatgtcatgaattcgtcgaatgttctgaagatgctgtgggttttgtggtcctgggatgtccacttcggtaaagatcgataagattcaaagtactcgttaatcgttatacattctga</dnaseqindica> |
| External Link(s) |
