Difference between revisions of "Os05g0108800"
(→Evolution) |
(→Evolution) |
||
| Line 25: | Line 25: | ||
[[File:640px-1jex cyto b5.png|200px|thumb|left|cytchorome b5]] | [[File:640px-1jex cyto b5.png|200px|thumb|left|cytchorome b5]] | ||
3-D structures of a number of cytochrome b5 and yeast flavocytochrome b2 are known. The fold belongs to the α+β class, with two hydrophobic cores on each side of a β-sheet. The larger hydrophobic core constitutes the heme-binding pocket, closed off on each side by a pair of helices connected by a turn. The smaller hydrophobic core may have only a structural role and is formed by spatially close N-terminal and C-terminal segments. The two histidine residues provide the fifth and sixth heme ligands, and the propionate edge of the heme group lies at the opening of the heme crevice. Two isomers of cytochrome b5, referred to as the A (major) and B (minor) forms, differ by a 180° rotation of the heme about an axis defined by the α- and γ-meso carbons. In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering).<ref name="ref5"/><br /> | 3-D structures of a number of cytochrome b5 and yeast flavocytochrome b2 are known. The fold belongs to the α+β class, with two hydrophobic cores on each side of a β-sheet. The larger hydrophobic core constitutes the heme-binding pocket, closed off on each side by a pair of helices connected by a turn. The smaller hydrophobic core may have only a structural role and is formed by spatially close N-terminal and C-terminal segments. The two histidine residues provide the fifth and sixth heme ligands, and the propionate edge of the heme group lies at the opening of the heme crevice. Two isomers of cytochrome b5, referred to as the A (major) and B (minor) forms, differ by a 180° rotation of the heme about an axis defined by the α- and γ-meso carbons. In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering).<ref name="ref5"/><br /> | ||
| + | |||
| + | |||
Revision as of 07:38, 8 June 2014
Os05g0108800 encodes the protein Cytochrome b5.
Contents
Annotated Information
By blast, we can find the sequence of Os05g0108800is same to 'Cyto b5' in tobacco(query coverage is 100%), which encodes cytochrome b5, a rather conserved and essential protein.
Function
Cytochromes b5 are ubiquitous electron transport hemoproteins found in animals, plants, fungi and purple phototrophic bacteria. The microsomal and mitochondrial variants are membrane-bound, while bacterial and those from erythrocytes and other animal tissues are water-soluble. The family of cytochrome b5-like proteins includes (besides cytochrome b5 itself) hemoprotein domains covalently associated with other redox domains in flavocytochrome cytochrome b2 (L-lactate dehydrogenase; EC 1.1.2.3), sulfite oxidase (EC 1.8.3.1), plant and fungal nitrate reductases (EC 1.7.1.1, EC 1.7.1.2, EC 1.7.1.3), and plant and fungal cytochrome b5/acyl lipid desaturase fusion proteins. Cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi.[1][2] The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds.[3][4]A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion.[5]
Cytochrome b5 in some biochemical reactions
EC 1.6.2.2 cytochrome-b5 reductase
NADH + H+ + 2 ferricytochrome b5 → NAD+ + 2 ferrocytochrome b5 EC 1.10.2.1 L-ascorbate—cytochrome-b5 reductase
L-ascorbate + ferricytochrome b5 → monodehydroascorbate + ferrocytochrome b5 EC 1.14.18.2 CMP-N-acetylneuraminate monooxygenase
CMP-N-acetylneuraminate + 2 ferrocytochrome b5 + O2 + 2 H+ → CMP-N-glycoloylneuraminate + 2 ferricytochrome b5 + H2O EC 1.14.19.1 stearoyl-CoA 9-desaturase
stearoyl-CoA + 2 ferrocytochrome b5 + O2 + 2 H+ → oleoyl-CoA + 2 ferricytochrome b5 + H2O EC 1.14.19.3 linoleoyl-CoA 9-desaturase
linoleoyl-CoA + 2 ferrocytochrome b5 + O2 + 2 H+ → γ-linolenoyl-CoA + 2 ferricytochrome b5 + H2O
Expression
3-D structures of a number of cytochrome b5 and yeast flavocytochrome b2 are known. The fold belongs to the α+β class, with two hydrophobic cores on each side of a β-sheet. The larger hydrophobic core constitutes the heme-binding pocket, closed off on each side by a pair of helices connected by a turn. The smaller hydrophobic core may have only a structural role and is formed by spatially close N-terminal and C-terminal segments. The two histidine residues provide the fifth and sixth heme ligands, and the propionate edge of the heme group lies at the opening of the heme crevice. Two isomers of cytochrome b5, referred to as the A (major) and B (minor) forms, differ by a 180° rotation of the heme about an axis defined by the α- and γ-meso carbons. In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering).[5]
Evolution
This cDNA encodes a protein of 139 residues which exhibits a high degree of homology to other cytochrome b5s, the message for which is expressed predominantly in developing seeds and in pigmented flower tissue. You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
- ↑ Ozols J: Structure of cytochromeb 5 and its topology in the microsomal membrane. Biochim Biophys Acta 997 121–130 (1989).
- ↑ Rich PR, Bendall DS: Cytochrome components of plant microsomes. Eur J Biochem 55: 333–341 (1975).
- ↑ Kearns EV, Hugly S, Somerville CR: The role of cytochromeb 5 in Δ12 desaturation of oleic acid by microsomes of safflower (Carthamus tinctorius L.). Arch Biochem Biophys 284: 431–436 (1991).
- ↑ Smith MA, Cross AR, Jones OTG, Griffiths WT, Stymne S, Stobart AK: Electron transport components of the 1-acyl-2-oleoyl-sn-glycero-3-phosphocholine 537–1 (Δ12-desaturase) in microsomal preparations from developing safflower (Carthamus tinctorius L.) cotyledons. Biochem J 272: 23–29 (1990).
- ↑ 5.0 5.1 Mark A. Smith, A. Keith Stobart, Peter R. Shewry, Johnathan A. Napier:Tobacco cytochromeb 5: cDNA isolation, expression analysis andin vitro protein targeting. Plant Molecular Biology: 527-537(1994)
Structured Information
| Gene Name |
Os05g0108800 |
|---|---|
| Description |
Cytochrome b5 |
| Version |
NM_001060969.1 GI:115461668 GeneID:4337583 |
| Length |
1812 bp |
| Definition |
Oryza sativa Japonica Group Os05g0108800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:470434..472245 |
| Sequence Coding Region |
470569..470658,471609..471675,471795..472051 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttag</cdnaseq> |
| Protein Sequence |
<aaseq>MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGG DDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQ DKTPEFIIKILQFLVPLAILGLAVAIRIYTKSESA</aaseq> |
| Gene Sequence |
<dnaseqindica>136..225#1176..1242#1362..1618#atccccacgagacgagaaacctagcaaaaatctcgtctttcgccgcgctctccctcctctgattcctgctgttcttgatcttggatctcaattcccaaccaagaacacacagacagagaaaggaaggagaagaagatgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtctcatcttttgtttttcttttcttttcacgcttttacttacttgtactattcgatttcatgtttcgattcgtttcgttggttcttggttccctatcctccaacaacgtcctgagacctcgatctggtcggagtccacgaccagatcttggccgcggcgcagatctggccctccagccgccggcgtggggaccttgccagatctggtcttctccgacggtggccaacttctcttgtcccttggttgcagccaccaaacctcttcctcccctcctcgatccaaccttggtcttgttcatcgactggccactaaaccccaaataagcgagatagaatttggattcgtttcgttggttattgtttctctgatgctgtgatggtggctagatcatggcagatctgcccagtaaagtcgaattttgtttgattccaccgcacctcctgaggaatcggtccaatcctgtgaattcttctcttctttcctgctgattggattgtctacatgggctttacctggaaacaggggtgagtgctagcagattcaaacatcatggactgactgctcctaaacaagttccatatgaaaacctgttctacatgctttttttcttttactcttcactcgttgtcagtcaaacactgcaaaatttgtccctgcgcctattctgcaagagcttcttgttagtacaactgaagaatcaatcctctgttccaacttggcatctggacagaataatgaatgtttcataggaaaggctcagctcaactaagtaaatcatgttgattggccttaaaacacacttcattaagagtctgttttttttatattggacatgataagaataatatggctgttttttattattaatgttttttcttggtaacagtgcttctattgatgaacctaccctgtttacctgatctcaccagtgttctgcaatactatccaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggtacgccttctcaattctcatgttctggccttctgagtagtgaccactactgatgaattaactgagtttgcaatggatggtttagcttacactttgaaatatacatggaccttctgcaggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttagtgctgttctcttagtgttataagagtggaaggtaccgaataagttagcaagagttttgtgtgattcataccagtgtaacatgtcatgaattcgtcgaatgttctgaagatgctgtgggttttgtggtcctgggatgtccacttcggtaaagatcgataagattcaaagtactcgttaatcgttatacattctga</dnaseqindica> |
| External Link(s) |