Difference between revisions of "Os07g0616800"
Chenlizhao (talk | contribs) |
Chenlizhao (talk | contribs) (→References) |
||
| Line 44: | Line 44: | ||
* <ref name="ref2"> | * <ref name="ref2"> | ||
Puji Lestari, Gian Lee, Tae-Ho Ham, Reflinur, Mi-Ok Woo, Rihua Piao, Wemzhu Jiang, Sang Ho Chu, Joohyun Lee, Hee-Jong Koh. Single Nucleotide Polymorphisms and Haplotype Diversity in RiceSucrose Synthase 3[J]. Journal of Heredity, 2011, 102:735-746. | Puji Lestari, Gian Lee, Tae-Ho Ham, Reflinur, Mi-Ok Woo, Rihua Piao, Wemzhu Jiang, Sang Ho Chu, Joohyun Lee, Hee-Jong Koh. Single Nucleotide Polymorphisms and Haplotype Diversity in RiceSucrose Synthase 3[J]. Journal of Heredity, 2011, 102:735-746. | ||
| + | </references> | ||
/ref> | /ref> | ||
* <ref name="ref3"> | * <ref name="ref3"> | ||
Ai-Yu <Wang, Mau-Han Kao, Wei-Horng Yang, Yiyang Sayion, Li-fei Liu, Ping-Du Lee, Jong-Ching Su. Differentially and developmentally regulated expression of three rice sucrose synthase genes[J]. Plant Cell Phyisol, 1999, 40:800–807. | Ai-Yu <Wang, Mau-Han Kao, Wei-Horng Yang, Yiyang Sayion, Li-fei Liu, Ping-Du Lee, Jong-Ching Su. Differentially and developmentally regulated expression of three rice sucrose synthase genes[J]. Plant Cell Phyisol, 1999, 40:800–807. | ||
</references> | </references> | ||
| − | |||
==Structured Information== | ==Structured Information== | ||
Revision as of 08:39, 8 June 2014
Please input one-sentence summary here.
Contents
characteristic
The current work [1] confirms that six genes comprise the entire rice Sucrose synthase (SUS) gene family.Function
In higher plants sucrose is the major form in which carbohydrate is transported from photosynthetic source tissues to sink tissues, and its subsequent cleavage in the sink tissues is the first step for utilization of the photoassimilate in various metabolic pathways. Sucrose synthase (Sus) plays a major role(s) in sucrose metabolism in a number of different growth processes within a variety of sink tissues. Sus catalyzes a reaction of sucrose and UDP to form fructose and UDPG, the latter being a precursor of complex saccharide biosynthesis. Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme. In addition to these major roles in sink tissue metabolism, Sus gene expression has also been reported to be induced in response to environmental stresses such as hypoxia and cold. Further roles for Sus were proposed in other important metabolic processes including nitrogen fixation in legume nodules and phloem loading and/or unloading. Specially, rice sucrose synthase 3(RSUS3) has its own role in sucrose metabolism. First, Tatsuro Hirose et al [1] and Wang et al [2] suggest that SUS3 play a catalyzed reaction when the RSUS1 which is rich in the phloem and aleurone layers of the seeds, transport sugar into the endosperm cells. Second, RSUS3 is expressed predominantly in rice seed endosperm and is thought to play an important role in starch filling during the milky stage of rice seed ripening [3]. Third, SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain and participated in the cleavage of sucrose, taken up by aleurone, thus providing the precursors for starch synthesis. [1]
Expression
Wang et al [2] used the mono-specific antibodies for three RSuS isoforms and found differentially and developmentally regulated expression of three rice sucroce synthase genes. The expression of RSuS3 could only be detected in the seeds in etiolated seedlings.Nucleotide Polymorphisms
Nucleotide changes and indels at the RSUS3 locus were identified, and the results are summarized in picture 10.Allele Distribution
Puji Lestari [3] adopted Tajima’s D test and Fu and Li’s D* and F* tests to evaluate the allele distribution in the germplasm used in this study and assess the neutrality of the mutations. The frequency spectrum of polymorphic sites for the total length was skewed toward a deficit of low-frequency alleles relative to expectations based on a positive outcome by Tajima’s D test (0.923). The Tajima’s D value for the total region of RSUS3 excluding intron was lower than that for the entire length. Separate Tajima’s D tests for each region (upstream, coding, and noncoding region) revealed positive and nonsignificant departures from the neutral expectation, with the exception of the 3’ downstream NTR, which had a negative Tajima’s D value (D = -0.326). Using the coalescent process to test the neutrality of the mutations in the entire gene sequence, similar positive values were obtained, but significant deviation from the neutral expectation (P <0.02) occurred with the Fu and Li D* (1.959) and F* (1.894) tests. A summary of this neutrality test is presented in picture 11.Haplotype Diversity
Some researchers predicted initially the number of haplotypes of RSUS3 using the coalescent theory. The predicted haplotype numbers for each functional part of the promoter, transcript, and downstream region were 17, 12, and 12, respectively. The highest haplotype diversity (Hd: 0.866) was observed in the promoter region, and the lowest Hd (0.828) was observed in the downstream region. Puji Lestari [3] analyzed the entire region excluding intron revealed that the nucleotide diversity ranged from 1.645 to 1.801, and the estimated haplotype number was from 10 to 22. Finally, using bootstrap analysis, the genealogy of the sequences containing 11 major highly differentiated haplotypes groups across the region of 5’ NTR-transcript-3’ NTR was successfully assembled. They constructed a neighbor joining tree to illustrate the phylogenetic branching order between the 5’ NTR transcript-3’ NTR and to elucidate the evolutionary history(picture 12).Recombination
Puji Lestari [3] used the algorithm of Hudson and Kaplan to determine that at least 11 recombination events were responsible for the polymorphism pattern identified in the RSUS3 gene. The recombinations were detected in the informative sites of the 3 regions: a minimum of 3 recombinations in the 5’ NTR (-1639 to -1630, -1594 to -1588, and -679 to -600), 4 in the transcribed region (1072–2734, 2734–3305, 4117–4148, and 4148–4572), 1 in the position between the transcribed region and the downstream region (4572–5627), and 3 in the 3’ NTR (5627–5923, 6041–6050, and 6050–6055). A total of 48 polymorphic sites in the entire region without intron were analyzed for evidence of recombination.
Evolution
Sequence analysis revealed that RSUS2 and RSUS3 may have evolved from the same ancestor after the divergence of RSUS1.
Labs working on this gene
- National Agricultural Research Center,1-2-1 Inada, Joetsu, Niigata 943-0193, Japan
- CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 2601, Australia
- Department of Agricultural Chemistry, National Taiwan University, Taipei, Taiwan 106, R.O.C.
- Department of Agronomy, National Taiwan University, Taipei, Taiwan 106, R.O.C.
- The Department of Plant Science, Plant Genomics and Breeding Institute, and Research Institute of Agriculture and Life Sciences, Seoul National University, Seoul 151-921, Korea
- The National Academy of Agricultural Sciences, Rural Development Administration, Suwon, Korea
- The Indonesian Center for Agricultural Biotechnology and Genetic Resources Research and Development, Bogor, Indonesia
References
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Hirose T, Scofield GN, Terao T. An expression analysis profile for the entire sucrose synthase gene family in rice[J]. Plant Sci, 2008, 174:534–543.
- ↑ 2.0 2.1 2.2 2.3 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 Cite error: Invalid
<ref>tag; no text was provided for refs namedref3
/ref>
- <ref name="ref3">
Ai-Yu <Wang, Mau-Han Kao, Wei-Horng Yang, Yiyang Sayion, Li-fei Liu, Ping-Du Lee, Jong-Ching Su. Differentially and developmentally regulated expression of three rice sucrose synthase genes[J]. Plant Cell Phyisol, 1999, 40:800–807. </references>
Structured Information
| Gene Name |
Os07g0616800 |
|---|---|
| Description |
Sucrose synthase 3 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 3) |
| Version |
AK100306.1 GI:32985515 |
| Length |
2771 bp |
| Definition |
Oryza sativa Japonica Group cDNA clone:J023078G01, full insert sequence. |
| Source |
Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:26089796..26095289 |
| Sequence Coding Region |
{{{CDS}}} |
| Expression | |
| Genome Context |
{{{GCID}}} |
| Gene Structure |
<gbrowseImage2> name=NC_008400:26089796..26095289 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggggga aactactgga gaacgtgccc 121 tgacccgtct ccacagcatg agggagcgca tcggcgattc cctctccgcg cacaccaatg
181 agcttgtggc tgtcttctca aggcttgtga accaaggaaa gggaatgcta cagccccacc
241 agatcattgc tgagtacaac gccgcaatcc ctgagggcga gcgtgagaag ctgaaggact
301 ctgccttaga ggatgtcctg aggggagcac aggaggcgat tgtcatccct ccatggattg
361 cccttgccat tcgcccaagg cctggtgtct gggagtatct gaggatcaat gtaagccagc
421 ttggtgttga ggagctgagt gtccctgaat acttgcagtt caaggagcag cttgtggatg
481 gaagcaccca gaacaacttt gtgcttgagc tggactttga gccattcaat gcctccttcc
541 ctcgcccatc gttgtcgaag tctattggca atggggtgca gttcttgaac aggcacctgt
601 cgtcaaagct gttccatgac aaagagagca tgtaccccct gctcaacttt cttcgtgcgc
661 acaactacaa agggatgacc atgatgttga acgacaggat tcgcagtctc gatgctctcc
721 aaggtgcatt gaggaaggca gaaaaacatc ttgcaggcat tacagctgac accccatatt
781 cagagttcca tcacaggttc caagagcttg gtttggagaa gggttggggt gactgcgctc
841 agcgagtgcg tgagactatt caccttctct tggaccttct tgaggcccct gagccgtccg
901 ccttggagaa gttccttgga acaatcccaa tggtgttcaa tgttgttatc ctctccccgc
961 atggttactt tgcacaggct aatgtcttgg ggtaccctga taccggtggg caggttgtct
1021 acattttgga tcaagtccgt gctatggaga atgagatgct gctgaggatc aagcaacaag
1081 gtctaaacat cacaccaagg attctcattg tgaccaggtt gctacctgat gcgcatggca
1141 ccacatgtgg ccagcgcctt gagaaggtcc taggcactga gcacactcat atcctgcgtg
1201 tgccattccg aacagaaaat gggactgttc gcaaatggat ctcgcgtttt gaagtctggc
1261 cttacctgga aacttacacc gatgatgtgg cacacgagat ttctggagag ctgcaggcca
1321 cccctgacct gatcattggg aactacagtg atggcaacct tgttgcatgt ttgctggcac
1381 acaagttggg tgtcactcat tgtacaatcg cccatgcact tgagaaaacc aagtacccca
1441 actccgacct ttactggaag aagtttgagg atcactatca cttctcctgc cagttcacag
1501 ctgacctgat tgcaatgaac catgctgact tcatcatcac aagtaccttc caggagattg
1561 ctggaaacaa ggaaactgtg gggcagtatg agtctcacat ggcattcaca atgcctggcc
1621 tttatcgtgt tgtccatggt atcgatgtct ttgaccccaa gttcaacatc gtctctcctg
1681 gtgctgacat gtccatctac ttcccattca ccgaatcaca gaagaggctc acctctctcc
1741 atttagagat agaggagcta ctcttcagtg atgttgaaaa cactgagcac aagtttgttc
1801 tgaaggacaa gaagaagcca atcatcttct cgatggctag gctagaccat gtcaagaatt
1861 tgactggtct ggttgagttg tatggtcgga accctcgcct gcaagagcta gtaaaccttg
1921 tggttgtctg tggtgaccat ggcaaggaat ccaaggacaa agaagagcag gctgagttca
1981 agaagatgtt taatctgatc gagcagtaca atttgaatgg ccacatccgc tggatctccg
2041 ctcagatgaa ccgtgtccgc aatggtgagc tctaccgcta catctgcgac atgaggggag
2101 cctttgtgca gcccgctctc tatgaggcct ttgggctaac tgtgattgag gccatgacct
2161 gtggtcttcc aacatttgca actgcctatg gtggtccagc cgagatcatc gtgcacggcg
2221 tgtctggcta ccacattgat ccttaccaga acgacaaggc ctcggcgctg ctcgtggagt
2281 tctttgagaa gtgtcaggaa gacccaaacc actggatcaa gatctcgcag ggtggacttc
2341 agcgcatcga ggagaagtac acatggaagc tctactctga gaggctgatg actctctccg
2401 gtgtctacgg tttctggaag tatgtcacca acctcgacag gcgtgagaca cgccgctacc
2461 tggagatgct gtacgccctc aagtaccgca agatggctac caccgttcca ttggccattg
2521 agggagaggc ctccaccaaa tga</cdnaseq>
|
| Protein Sequence |
<aaseq>MGETTGERALTRLHSMRERIGDSLSAHTNELVAVFSRLVNQGKG MLQPHQIIAEYNAAIPEGEREKLKDSALEDVLRGAQEAIVIPPWIALAIRPRPGVWEY
LRINVSQLGVEELSVPEYLQFKEQLVDGSTQNNFVLELDFEPFNASFPRPSLSKSIGN
GVQFLNRHLSSKLFHDKESMYPLLNFLRAHNYKGMTMMLNDRIRSLDALQGALRKAEK
HLAGITADTPYSEFHHRFQELGLEKGWGDCAQRVRETIHLLLDLLEAPEPSALEKFLG
TIPMVFNVVILSPHGYFAQANVLGYPDTGGQVVYILDQVRAMENEMLLRIKQQGLNIT
PRILIVTRLLPDAHGTTCGQRLEKVLGTEHTHILRVPFRTENGTVRKWISRFEVWPYL
ETYTDDVAHEISGELQATPDLIIGNYSDGNLVACLLAHKLGVTHCTIAHALEKTKYPN
SDLYWKKFEDHYHFSCQFTADLIAMNHADFIITSTFQEIAGNKETVGQYESHMAFTMP
GLYRVVHGIDVFDPKFNIVSPGADMSIYFPFTESQKRLTSLHLEIEELLFSDVENTEH
KFVLKDKKKPIIFSMARLDHVKNLTGLVELYGRNPRLQELVNLVVVCGDHGKESKDKE
EQAEFKKMFNLIEQYNLNGHIRWISAQMNRVRNGELYRYICDMRGAFVQPALYEAFGL
TVIEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDPYQNDKASALLVEFFEKCQEDPNH
WIKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVTNLDRRETRRYLEMLYALKY
RKMATTVPLAIEGEASTK</aaseq>
|
| Gene Sequence |
<dnaseqindica> 1 gagcatccat cggttctctg ctctgttcat ccatagagtt tcctcctctt ctcctttagt 61 gcaaggcttg aggatccatc tagaagatag caatggggga aactactgga gaacgtgccc
121 tgacccgtct ccacagcatg agggagcgca tcggcgattc cctctccgcg cacaccaatg
181 agcttgtggc tgtcttctca aggcttgtga accaaggaaa gggaatgcta cagccccacc
241 agatcattgc tgagtacaac gccgcaatcc ctgagggcga gcgtgagaag ctgaaggact
301 ctgccttaga ggatgtcctg aggggagcac aggaggcgat tgtcatccct ccatggattg
361 cccttgccat tcgcccaagg cctggtgtct gggagtatct gaggatcaat gtaagccagc
421 ttggtgttga ggagctgagt gtccctgaat acttgcagtt caaggagcag cttgtggatg
481 gaagcaccca gaacaacttt gtgcttgagc tggactttga gccattcaat gcctccttcc
541 ctcgcccatc gttgtcgaag tctattggca atggggtgca gttcttgaac aggcacctgt
601 cgtcaaagct gttccatgac aaagagagca tgtaccccct gctcaacttt cttcgtgcgc
661 acaactacaa agggatgacc atgatgttga acgacaggat tcgcagtctc gatgctctcc
721 aaggtgcatt gaggaaggca gaaaaacatc ttgcaggcat tacagctgac accccatatt
781 cagagttcca tcacaggttc caagagcttg gtttggagaa gggttggggt gactgcgctc
841 agcgagtgcg tgagactatt caccttctct tggaccttct tgaggcccct gagccgtccg
901 ccttggagaa gttccttgga acaatcccaa tggtgttcaa tgttgttatc ctctccccgc
961 atggttactt tgcacaggct aatgtcttgg ggtaccctga taccggtggg caggttgtct
1021 acattttgga tcaagtccgt gctatggaga atgagatgct gctgaggatc aagcaacaag
1081 gtctaaacat cacaccaagg attctcattg tgaccaggtt gctacctgat gcgcatggca
1141 ccacatgtgg ccagcgcctt gagaaggtcc taggcactga gcacactcat atcctgcgtg
1201 tgccattccg aacagaaaat gggactgttc gcaaatggat ctcgcgtttt gaagtctggc
1261 cttacctgga aacttacacc gatgatgtgg cacacgagat ttctggagag ctgcaggcca
1321 cccctgacct gatcattggg aactacagtg atggcaacct tgttgcatgt ttgctggcac
1381 acaagttggg tgtcactcat tgtacaatcg cccatgcact tgagaaaacc aagtacccca
1441 actccgacct ttactggaag aagtttgagg atcactatca cttctcctgc cagttcacag
1501 ctgacctgat tgcaatgaac catgctgact tcatcatcac aagtaccttc caggagattg
1561 ctggaaacaa ggaaactgtg gggcagtatg agtctcacat ggcattcaca atgcctggcc
1621 tttatcgtgt tgtccatggt atcgatgtct ttgaccccaa gttcaacatc gtctctcctg
1681 gtgctgacat gtccatctac ttcccattca ccgaatcaca gaagaggctc acctctctcc
1741 atttagagat agaggagcta ctcttcagtg atgttgaaaa cactgagcac aagtttgttc
1801 tgaaggacaa gaagaagcca atcatcttct cgatggctag gctagaccat gtcaagaatt
1861 tgactggtct ggttgagttg tatggtcgga accctcgcct gcaagagcta gtaaaccttg
1921 tggttgtctg tggtgaccat ggcaaggaat ccaaggacaa agaagagcag gctgagttca
1981 agaagatgtt taatctgatc gagcagtaca atttgaatgg ccacatccgc tggatctccg
2041 ctcagatgaa ccgtgtccgc aatggtgagc tctaccgcta catctgcgac atgaggggag
2101 cctttgtgca gcccgctctc tatgaggcct ttgggctaac tgtgattgag gccatgacct
2161 gtggtcttcc aacatttgca actgcctatg gtggtccagc cgagatcatc gtgcacggcg
2221 tgtctggcta ccacattgat ccttaccaga acgacaaggc ctcggcgctg ctcgtggagt
2281 tctttgagaa gtgtcaggaa gacccaaacc actggatcaa gatctcgcag ggtggacttc
2341 agcgcatcga ggagaagtac acatggaagc tctactctga gaggctgatg actctctccg
2401 gtgtctacgg tttctggaag tatgtcacca acctcgacag gcgtgagaca cgccgctacc
2461 tggagatgct gtacgccctc aagtaccgca agatggctac caccgttcca ttggccattg
2521 agggagaggc ctccaccaaa tgatctggcc ttacccggtg aaaagaatgg gcaatgggtg
2581 ctccattgtt gcagtgctga tccaggggtg aagaaaaaca gaaatcgagg aacgaatgca
2641 tccatttagt ttctaagggt ttagttgatt tcagggccag ttcttgtggg gttttcaatg
2701 gaagaaattg atgtaatgct ctggcctttt catggatact atgaatgaaa taaatgaata
2761 acaagattct c
</dnaseqindica>
|
| External Link(s) |