Difference between revisions of "Os08g0174700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
Line 18: Line 18:
  
 
===Evolution===
 
===Evolution===
Phylogenetic analysis and suppression of a weak Arabidopsis mutant bri1-5 indicated that OsBAK1 (Os08g0174700) is the closest relative of Arabidopsis BAK1(AtBAK1). Genetic, physiological, and biochemical analyses all suggest that the function of OsBAK1 is conserved with AtBAK1(Fig.6 A phylogenetic tree of the SERK family protein kinases drawn on the basis of predicted entire amino acid sequences ‎)<ref name="ref3" />.[[File:A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.jpg|right|thumb|150px|''Fig6.A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.(from reference <ref name="ref3"/>).'']]
+
Phylogenetic analysis and suppression of a weak Arabidopsis mutant bri1-5 indicated that OsBAK1 (Os08g0174700) is the closest relative of Arabidopsis BAK1(AtBAK1). Genetic, physiological, and biochemical analyses all suggest that the function of OsBAK1 is conserved with AtBAK1(Fig.6‎)<ref name="ref3" />.[[File:A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.jpg|right|thumb|150px|''Fig.6 A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.(from reference <ref name="ref3"/>).'']]
  
 
===References===
 
===References===

Revision as of 08:44, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

the gene encode a somatic embryogenesis(SERK-family)receptor-like protein kinase 1(OsSERK1) ,it also named BRI1-Associated receptor Kinase 1 (OsBAK1). The expression of OsBAK1changed important agricultural traits of rice such as plant height, leaf erectness, grain morphologic features, and disease resistance responses. A new rice variety with erect-leaf and normal reproduction can be generated simply by suppressing the expression level of OsBAK1[1].

Reduceing levels of OsBAK1 and decreasing sensitivity to BL will lead to semidwarfism in overall growth and result in abnormal growth patterns, especially in leaf development(Fig.1)
Fig.1The_unnormal_growth_condition_of_OsBAK1.(The outer appearance of OsBAK1RNAi line leaves (right) showing constitutive sickness compared with those of control plants (left) grown for two weeks. (from reference [2]).
. OsBAK1RNAi transgenic rice plants are defective in the development of bulliform cells in the leaf epidermal layer and increase expression level of pathogenesis related gene and enhance susceptibility to a rice blast-causing fungal pathogen, Magnaporthe oryzae (Fig.2)
Fig.2 Higher susceptibility to biotic stress of leaves of OsBAK1RNAi plants.(Extent of OsBAK1RNAi line (right) infection with Magnaporthe oryzae compared to wild-type plant (left) grown for 7 weeks. Enlarged leaf features of them are shown in the lower panel.)(from reference [2]).
. OsBAK1, play versatile roles in rice growth and development[2].

Expression

Expression of OsSERK1 and in various organs of rice

Using a set of OsSERK1 primers (K-1; 5’AT(CT)AT(ATC)CATCG(AT)GATGTCAA3’ and K6-2; 5’CCATCTTGGGGCGTTCTGTG3’, where nucleotides in parentheses are a mixture). Actin (RAc-1; 5’AACTGGGATGATATGGAGAA3’, RAc-2; 5’CCTCCAATCCAGACACTGTA3’) was used as an internal control. The result showed that OsSERK1 was expressed in all organs and calli examined with different levels.Expression of OsSERK1 was relatively strong in a 1 DAP flower which contained a very early embryo, a leaf blade and a shoot apex[1]. A callus on a regeneration medium with both cytokinin and auxin did not show significant change of the level of the OsSERK1expression in comparison to a callus on a callus-inducing medium(Fig.3 ).
Fig.3 Expression of OsSERK1 and in various organs of rice(Poly(A)+RNAs isolated from the indicated organs were reversetranscribed and used as templates of the PCR. RT-PCR products were detected by Southern blot (OsSERK1) or ethidium bromide staining (actin). + and–indicate whether reverse transcriptase was add). (from reference [1]).

OsSERK genes were expressed in various organs but with some tissue specificity

The OsSERK1 promoter showed reporter gene activities in some specific tissues in a germinating seed, leaf and root, but not in a developing embryo[1]. This promoter activity suggests that OsSERK1 may have roles in non-embryonic tissues rather than in the embryo[1].OsSERK1 might also be involved in signaling of or response to phytohormones in these tissues(Fig.4 ).
Fig.4 Tissue-specific_GUS_activities_in_the_OsSERK1-GUS_rice_plants((A) 1-day imbibed embryo of plant #7. (B) Lamina joint of plant #7. (C) Growing lateral roots of plant #7. (D) Developing embryo (10 DAP) of plant #7. (E) 1-day imbibed embryo of plant #23. (F) Lamina joint of plant #23. (G) Growing lateral roots of plant).(from reference [1]).

The subcellular localization of OsBAK1 protein

The OsBAK1 protein in onion epidermis cells is located at plasma membrane[3] (Fig.5)
Fig.5 The_subcellular_localization_of_OsBAK1_protein_in_onion_epidermis_cellsThe upper panel shows the 35S::GFP signal alone, which is distributed on the plasma membrane, cytoplasm and nucleus; the middle panel displays the signal from 35S::OsBAK-GFP which is primarily located in the plasma membrane; the lower panel shows 35S::OsB). (from reference [3]).

Evolution

Phylogenetic analysis and suppression of a weak Arabidopsis mutant bri1-5 indicated that OsBAK1 (Os08g0174700) is the closest relative of Arabidopsis BAK1(AtBAK1). Genetic, physiological, and biochemical analyses all suggest that the function of OsBAK1 is conserved with AtBAK1(Fig.6‎)[3].
Fig.6 A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.(from reference [3]).

References

Please input cited references here. [1] [2] [3] [4]

Structured Information

Gene Name

Os08g0174700

Description

Similar to SERK1 (Fragment)

Version

NM_001067643.1 GI:115475022 GeneID:4344785

Length

6295 bp

Definition

Oryza sativa Japonica Group Os08g0174700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:4343174..4349468

Sequence Coding Region

4343458..4343542,4345257..4345389,4345463..4345534,4345871..4346014,4346735..4346806
,4346933..4347004,4347088..4347200,4347342..4347473,4347551..4347892
,4347975..4348369,4348640..4348954

Expression

GEO Profiles:Os08g0174700

Genome Context

<gbrowseImage1> name=NC_008401:4343174..4349468 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:4343174..4349468 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcgcatcggtgggcggtgtgggcggtgctgctgctgcggctgctcgtgccggcggcgcgggtgctcgccaacatggaaggtgatgcattgcatagcttgaggactaatttagttgatcctaataatgttctacaaagttgggacccaactctggtcaatccgtgcacttggtttcatgttacttgcaataacgacaacagtgttatcagagttgatcttgggaatgctgcactatcaggcactttggtcccacaacttgggcaactaaaaaacttgcaatacctggagctctacagtaataacataagcggaacgatacctagtgaacttggaaacctcacaaacttggtcagtttggatttgtacttgaacaacttcactggtccaataccagattcacttggaaacctattgaagctacgattcctgcgtcttaacaataacagcctttcgggttcaattcctaaatcactaactgctatcactgccctacaagttctagatctttcaaacaacaatttgtctggagaagttccatcaactggttccttttcattattcacccctatcagttttgccaacaacccttccttgtgtggtcctgggaccacaaaaccttgccctggtgctccccccttttccccacctcctccatataatcctccaactcctgtgcagtcaccagggagttcatctagtactggagcaattgctggtggagtggctgctggagcagccttgctatttgctattcctgctattggttttgcatggtatcggcgcaggaaaccccaagagcatttctttgatgtgcctgctgaggaggatccagaggtccatcttggccagcttaaaagattttcactacgagaactacaagttgcaacagataccttcagcaataaaaacattctcggaagaggtgggtttggcaaggtctataaaggaagattagcagatggttctttagtagctgttaagagactaaaggaggagagaacacctggtggggaactacagtttcaaacagaagttgagatgattagcatggctgtacatagaaatctgctgcgtttacgagggttctgtatgacacccacagaaaggttgcttgtgtatccatacatggctaatggaagcgttgcgtcacgtcttagagaacggccaccatcggaacctccacttgattggcgaacaagaagaaggattgcgttgggttccgccagggggctgtcctatttacatgatcattgtgacccaaagattatccatcgtgatgtcaaagctgcaaatattttattagatgaagactttgaagctgtagtaggggactttggtttggccaaactaatggattacaaggatacccatgtaacaactgcagttcgtggaacaattgggcatattgcaccagaatatctttcaacaggaaaatcatctgagaaaactgatgtatttggttatgggattatgcttttggagcttataacaggacaacgtgcctttgaccttgctcgtctagccaatgatgatgatgtcatgctactggactgggtaaaaggattactcaaggagaaaaggctggagatgttggttgatccagatttacagagcaactacattgatgttgaggtagaatcactaatccaggttgctcttctttgcacacaaggctcccccacagaacgccccaagatggcggaggttgtgaggatgcttgaaggtgatggccttgccgagagatgggaggagtggcagaagatagaagtagtacggcaggaggtagagcttggccctcatcggaactcagagtggattgtcgactcgacggacaaccttcatgcggttgagctatcagggccgaggtga</cdnaseq>

Protein Sequence

<aaseq>MAAHRWAVWAVLLLRLLVPAARVLANMEGDALHSLRTNLVDPNN VLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAALSGTLVPQLGQLKNLQYLELYSN NISGTIPSELGNLTNLVSLDLYLNNFTGPIPDSLGNLLKLRFLRLNNNSLSGSIPKSL TAITALQVLDLSNNNLSGEVPSTGSFSLFTPISFANNPSLCGPGTTKPCPGAPPFSPP PPYNPPTPVQSPGSSSSTGAIAGGVAAGAALLFAIPAIGFAWYRRRKPQEHFFDVPAE EDPEVHLGQLKRFSLRELQVATDTFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEE RTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERPP SEPPLDWRTRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLA KLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLAR LANDDDVMLLDWVKGLLKEKRLEMLVDPDLQSNYIDVEVESLIQVALLCTQGSPTERP KMAEVVRMLEGDGLAERWEEWQKIEVVRQEVELGPHRNSEWIVDSTDNLHAVELSGPR </aaseq>

Gene Sequence

<dnaseqindica>285..369#2084..2216#2290..2361#2698..2841#3562..3633#3760..3831#3915..4027#4169..4300#4378..4719#4802..5196#5467..5781#atcgacggtataaagcgaggcgacgaactgactcgactcaactcaaccccccccaaaaaaaagaagaaaaaaaagaaaaagaaaaaaaagtcgtcgaaaagcgagagaaggggatcgattcgaagagagaggaggtaaagcggcggcgggagaatcttcgccggatcggcggcggtggcggaggaggaggaggaggaggaggaagagggtggtgctgatttggtgtggaggcggggaaatgcgtgatgtgtgagatctagggcgtggggaggcggatcgcggcaatggcggcgcatcggtgggcggtgtgggcggtgctgctgctgcggctgctcgtgccggcggcgcgggtgctcgccaacatggaaggtgggtggggggggaggtttgcgtttgagttgagcttttgcttgggttttggtcgatctggggtgtgttcttgctgggttggagtggattggtgtcgggagcttggggggtggctgcttgcttggcttggtttgagcagttagtacaagttgccgcggctgctggtttttgctgtgtgtgtaagttgctacgagacgtcgcttgattttggtttgatgcgtggccgctttgtacggatcctaccttttttactctccctcgcggaagaatcggagcattttctcgaatttttctccggtcgaatttggacttctctgcgttccaaattcactccgaattcccctagcctgtgaattgcttcaaaaatctgcgcaaagtcgggagctaaatttgcgctttcaaaatgtgaaacccttgtcggaaaaaagttgccatcgcgtttgatttaatttaatttaattttccatgcatttggatcatgtgttctattgaatgaagatttgaactgtgctgcgccgatgctgcacgtttcggagatttcccctttctatcgggtttctgcgtgcgcttgagagagctactgttgcattaaatcgcgttgctacacgttgcttgctagttgttcatggactaatctgctagagctgtgttaatcgattctttcccgtggttgttaggtcttgattaggacgtctaatgacgtggttttgctatttcgggccattgttagattcgagctgtcggtgcctaagttcgtgacataattgggttaccttttcgcgcgcgcgtgcgggttggtggctaggtgatttttcaagccggactttgtgtctaatcatggtacgaaatgggatggatcgtttcgattgcggattttctcgagcatggcttgtttagtcttgagatcccagttgcttaggcctgcctgggattgattaggacgttgatgcgcgtttgacgacgctagactgctaattttgggggtgggattggttgtatgtgtgtagttctagttggggattcggcaaattgtagtgggggcctgtgagctgtgggtcaaattgtattttccaggacaattggtagttgatgtgtgatcttgaagcttcaagcacctgaagcctgatggtgattgcttgtatttgaaaactttggtagtagtaggatataaagaggccaagttggtgttgtaattttcattttagttcgaccctttgatgctgatctcttacttaggtacttactttggagtgattcataagaaaatttaaaagcttattcacgacttacattctcataattgagatgttctcataattgatgatattttgagtttggctcactggttttaagtctagcgtctaagagttatctttcatgtacttatttgcccctttgtcatatactagagtaacaatttaactttttttaaaaacaaatcatactagctatggctgatgaaatggaatttttttgacatacaagtcagatagaattgtgccagatgcaatacaaacaccacatgaatcatgcatgctagttgaccttttggtttcgctccttttctgcatgatgatttggagtgttttcctttggacaaattctattttcaatctacacaacaattattagctactatttatgcacaatcctcattgattgtttggttaaattttattcacctgttgttgatacatgattctattattggcaggtgatgcattgcatagcttgaggactaatttagttgatcctaataatgttctacaaagttgggacccaactctggtcaatccgtgcacttggtttcatgttacttgcaataacgacaacagtgttatcagagtgtacgtgctaccttttgtctactatgcaatccacgcctcatacatttttattgaaattatctccatttttcagtgatcttgggaatgctgcactatcaggcactttggtcccacaacttgggcaactaaaaaacttgcaatacctgtaagttctcttcctgttgttaagtgttgtgcacatcattaaatgccattcctgctgcacatggtgcaatgttttgtcattgttctgatctttgaatttaggttaataccttgtaatgtgatatacgaattcatataataaatgttccattttgtaaataaatgcctattacctttcttatgtgagtatgtgatgaatgtctcacctatatcatcagaatatctacagtcacgtggagaaatattcctagctagtgtgttgtgctcagatcaactcaagccaatcactgagtattgtagagtattaatgttcattgttttcttctttatgatgcagggagctctacagtaataacataagcggaacgatacctagtgaacttggaaacctcacaaacttggtcagtttggatttgtacttgaacaacttcactggtccaataccagattcacttggaaacctattgaagctacgattcctgtatgcttctactttactagctaaccgcttctacatatttacgtttagtagagatatacatggtcagccatctcatatttttaggacttggaaactatacttaaatacatatgttttagctggtgagtatttttgagctctcaacctaaggatcttgaattttcagaacacatattctcttagcatagtgcattggaatattggatagagatgaaatgaatctgtggtagtatcggttcatggcaatataaagcctatcgttgagaatcatgctgatgtagccaaccatatagctaaattggttttgtcgaccatttaacctgatatcaatggacagttggacacgcaatgcttacatattttggataacagcacttaacatggtaatgccattgttttaccaacatgcacttataagtgggaaaacattgccatgtgtactacaacaaaatgatttggttcgatttgttttcctggtctgaccttttcattcaacttggttgtgcattagtacattgcaattatatttccagactgctgtttatgagatgatggatagcttttgctactttctcactccttttctgatgttttagggcatctcctatgcctcttgattttcgaagtagttttctagagtctctgcattatatttattctctgtcattttctgtcaatgttactaatttggtgacttattttgtatttctgcgaggataggcgtcttaacaataacagcctttcgggttcaattcctaaatcactaactgctatcactgccctacaagttctgtaagttatcccccccccctttattatacacttgtttaatcctttcttttcagtgtagtctttgttttttgttctgtggtttaattagtaaataacccatggtcaatgttttctatttaattaaagagatctttcaaacaacaatttgtctggagaagttccatcaactggttccttttcattattcacccctatcaggtaaaactagatttaataatgattgcagttcactgctcttttccaatacactgctgctatttacacttgcctgtcttttgcagttttgccaacaacccttccttgtgtggtcctgggaccacaaaaccttgccctggtgctccccccttttccccacctcctccatataatcctccaactcctgtgcagtcaccaggtgagatctgttcatattcacagctgtgcaacagccaacactatgatttttttttgttgcactgacgcgtggtacttatgctggtatggactatggaacatattgttgttgttctgacaataataacctcatgttctatagggagttcatctagtactggagcaattgctggtggagtggctgctggagcagccttgctatttgctattcctgctattggttttgcatggtatcggcgcaggaaaccccaagagcatttctttgatgtgcctggtaagcgtccaatagaacaagcgaacttggagaataatattgagccaactttgattgagattcattatttgttacagctgaggaggatccagaggtccatcttggccagcttaaaagattttcactacgagaactacaagttgcaacagataccttcagcaataaaaacattctcggaagaggtgggtttggcaaggtctataaaggaagattagcagatggttctttagtagctgttaagagactaaaggaggagagaacacctggtggggaactacagtttcaaacagaagttgagatgattagcatggctgtacatagaaatctgctgcgtttacgagggttctgtatgacacccacagaaaggttgcttgtgtatccatacatggctaatggaagcgttgcgtcacgtcttagaggtacgttgccttttttttttccaatctgacatccctgtatctttcagataattggagggttgatttgggttttatattatagaacggccaccatcggaacctccacttgattggcgaacaagaagaaggattgcgttgggttccgccagggggctgtcctatttacatgatcattgtgacccaaagattatccatcgtgatgtcaaagctgcaaatattttattagatgaagactttgaagctgtagtaggggactttggtttggccaaactaatggattacaaggatacccatgtaacaactgcagttcgtggaacaattgggcatattgcaccagaatatctttcaacaggaaaatcatctgagaaaactgatgtatttggttatgggattatgcttttggagcttataacaggacaacgtgcctttgaccttgctcgtctagccaatgatgatgatgtcatgctactggactgggtaattgactagcacaatcttcaattcaaattgcagtccatattcatgcccttttgtggcttgatgttgtgttgggagttagataaaattacttttatgtatgtccaaaatcgtatcatataaaaaatagtagttacagtaaggtcttaaaagtagtcctttttttaatcattatggcattagctaagctaagcataggattgaacatcatcgtctgagaaatacactgttatatggtaagccaatattcatgtgctgtgctttgtgcaggtaaaaggattactcaaggagaaaaggctggagatgttggttgatccagatttacagagcaactacattgatgttgaggtagaatcactaatccaggttgctcttctttgcacacaaggctcccccacagaacgccccaagatggcggaggttgtgaggatgcttgaaggtgatggccttgccgagagatgggaggagtggcagaagatagaagtagtacggcaggaggtagagcttggccctcatcggaactcagagtggattgtcgactcgacggacaaccttcatgcggttgagctatcagggccgaggtgatgacagcgcactggtagtttgctgctaattcttgtccgtcggaagagtgatttttatcagccatcctagtcgaatcgccatttgttcataccaaccaattggcccaatgtagccagctacaactatgttttgatgtatattgcttgatttgctccttgatgtgccgccttggatatcggtgacccgaaaacagcaggagcccaaggaactattgtcctgaagcttgcaagttgcaacaagatcccagtatgttaaagctcacaaggtagcagctaggagtgaggttgctgcggctgtttgctggacctgtgaaaattgtactgactggtgacatctaactattttgtaccaaatgtaaggaaaaaccatggtattattactttggcctcctctgggaaaggttcagaactttcagatgatgcagttggcctcactggtatactctatttggacatttgattatgatgtgtttactgtaaatgatacccagttctgaatcaaatgtaccttctgc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0174700, RefSeq:Os08g0174700

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Dan Li; Lei Wang; Min Wang; Yun-Yuan Xu; Wei Luo; Ya-Ju Liu; Zhi-Hong Xu; Jia Li; Kang Chong Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield Plant Biotechnology Journal, 2009, 7(8): 791-806.
  2. 2.0 2.1 2.2 2.3 Hye Sun Park;Hee Young Ryu;Beg Hab Kim;Sun Young Kim;In Sun Yoon;Kyoung Hee Nam A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice Molecules and Cells, 2011, 32(6): 561-569.
  3. 3.0 3.1 3.2 3.3 3.4 Yukihiro Ito; Kazuhiko Takaya; Nori Kurata Expression of SERK family receptor-like protein kinase genes in rice Biochimica et Biophysica Acta, 2005, 1730(3): 253-258.
  4. Guindon, S., and Gascuel, O.A simple, fast, and accurate algorithm to estimate large phylogenies by maximum likelihood.Syst. Biol. 2003,52, 696-704.