Difference between revisions of "Os04g0658300"

From RiceWiki
Jump to: navigation, search
(References)
(Expression)
Line 7: Line 7:
 
===Expression===
 
===Expression===
 
Ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco),the most abundant protein in the world, catalyzes the first step of photosynthetic carbon assimilation. CO2 fixed by rubisco is converted into carbohydrate, which provides most of the carbon resources and energy needed by life on earth. However, newly assembled rubisco is inactive and needs to be activated by rubisco activase (RCA) before it can fix CO2. RCA was discovered in a nuclear gene mutant of Arabidopsis thaliana. So far, it has been isolated from more than 10 species, including C3, C4 plants and green algae. Most of these plant species have two isoforms of activase that derive from the same transcript precursor by alternative splicing.
 
Ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco),the most abundant protein in the world, catalyzes the first step of photosynthetic carbon assimilation. CO2 fixed by rubisco is converted into carbohydrate, which provides most of the carbon resources and energy needed by life on earth. However, newly assembled rubisco is inactive and needs to be activated by rubisco activase (RCA) before it can fix CO2. RCA was discovered in a nuclear gene mutant of Arabidopsis thaliana. So far, it has been isolated from more than 10 species, including C3, C4 plants and green algae. Most of these plant species have two isoforms of activase that derive from the same transcript precursor by alternative splicing.
 +
the expression of the reporter gene under a full length rubisco activase promoter was observed to be tissue-specific and light-inducible
 +
in transgenic Arabidopsis, which is coincident to the native gene expression pattern of rubisco activase in rice.
  
 
===Evolution===
 
===Evolution===

Revision as of 13:58, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

the rice rubisco activase (Rca) gene, variants of the Rca gene promoter (one full-length and four deletion mutants) fused to the coding region of the bacterial reporter gene b-glucuronidase (GUS) were introduced into Arabidopsis via Agrobacteriummediated transformation

Expression

Ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco),the most abundant protein in the world, catalyzes the first step of photosynthetic carbon assimilation. CO2 fixed by rubisco is converted into carbohydrate, which provides most of the carbon resources and energy needed by life on earth. However, newly assembled rubisco is inactive and needs to be activated by rubisco activase (RCA) before it can fix CO2. RCA was discovered in a nuclear gene mutant of Arabidopsis thaliana. So far, it has been isolated from more than 10 species, including C3, C4 plants and green algae. Most of these plant species have two isoforms of activase that derive from the same transcript precursor by alternative splicing. the expression of the reporter gene under a full length rubisco activase promoter was observed to be tissue-specific and light-inducible in transgenic Arabidopsis, which is coincident to the native gene expression pattern of rubisco activase in rice.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Oryza sativa Japonica Group Key Laboratory of Photobiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, PR China b Key Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100080, PR China

References

Functional analysis of the rice rubisco activase promoter in transgenic Arabidopsis

  Zhipan Yang, Qingtao Lu, Xiaogang Wena, Fan Chen, Congming Lu

Structured Information

Gene Name

Os04g0658300

Description

Similar to Ribulose bisphosphate carboxylase/oxygenase activase, chloroplast precursor (RuBisCO activase) (RA)

Version

NM_001060663.1 GI:115461055 GeneID:4337267

Length

4502 bp

Definition

Oryza sativa Japonica Group Os04g0658300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:33973682..33978183

Sequence Coding Region

33973978..33974085,33974307..33974399,33974736..33974791,33975098..33975204,33975341..33975542
,33975804..33975858,33976400..33976461,33976611..33976724,33976844..33976906
,33977354..33977363,33977486..33977571,33977744..33978113

Expression

GEO Profiles:Os04g0658300

Genome Context

<gbrowseImage1> name=NC_008397:33973682..33978183 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:33973682..33978183 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccaccgccaccgccacctccctcgcctcctccgccgcgcaccgccgcctcccgccctcgcgctcagccgctagctccatcctgagagcccccaaccggggccgcctctgccccggctccccgtcggtgctccgcgcgtcgtcctcgtctccgtcgtctccccagcccaccgccggcggtgatgagggggaggaggaggaggaggggcggaggctgtcgaagcagtcgtcgtgggaggcgaaggactccgagggggatgactacctctaccgcctcgggaaggaggccgacaacatgaacatcgccgtcggcgcgcggagcggcatcgtcgacgacctcttcgtcggcaacttcctcggcaaagactcggatattgtgttcgattaccggcagaaagcgaccaggacgtttgagtacctgcaaggagattattacatcgcacccctcttccttgataaagttgcatgtcatattgtgaagaactaccttgcacatattcttactatcaagattccccttatacttggaatctggggtggaaaaggccaagggaaaacattccagactgaacttatatttagagcaatgggtgttgaacctgttattatgtctgctggagaactagaatctgagaaagcaggagaacctgggaggcttatacgtgaccgatacaggacggcttctcaagtaattcaaaaccaagggaaaatgagtgttttgatgatcaatgacctagatgctggtgttggaagatttggtaacacacaaatgacagtaaataatcaaattgtgattggaactttaatgaacttggcggataatccaaccagggttagcattggccagaaatggagagaatctgatgtaacacacagagtgccaataatagttaccggaaatgatttttcgacactgtatgctcccttgattcgtgatgggaggatggaaaagttctattggcagcctggccgtgaagatataattaacattgttcaccgcatgtatataaaggatggtttgtctttcgaggatgtatcaaaagttgtagacacttttccaaaccaagctctggacttttatggagctttgagatccaggacatacgatcgggcaatcttgcagtgggtagaagagattggtggtcatgaacaactaaatgaaaagcttctcaagcgaaagaaaggagaggagcttccaacatttattcctccaaagaccactgtagatgcgttgattgaatctggggactctctggtgaaagagcaagaactgataatgaattcgaaactgtcaaaagaatatatgaagaatttagatgattag</cdnaseq>

Protein Sequence

<aaseq>MATATATSLASSAAHRRLPPSRSAASSILRAPNRGRLCPGSPSV LRASSSSPSSPQPTAGGDEGEEEEEGRRLSKQSSWEAKDSEGDDYLYRLGKEADNMNI AVGARSGIVDDLFVGNFLGKDSDIVFDYRQKATRTFEYLQGDYYIAPLFLDKVACHIV KNYLAHILTIKIPLILGIWGGKGQGKTFQTELIFRAMGVEPVIMSAGELESEKAGEPG RLIRDRYRTASQVIQNQGKMSVLMINDLDAGVGRFGNTQMTVNNQIVIGTLMNLADNP TRVSIGQKWRESDVTHRVPIIVTGNDFSTLYAPLIRDGRMEKFYWQPGREDIINIVHR MYIKDGLSFEDVSKVVDTFPNQALDFYGALRSRTYDRAILQWVEEIGGHEQLNEKLLK RKKGEELPTFIPPKTTVDALIESGDSLVKEQELIMNSKLSKEYMKNLDD</aaseq>

Gene Sequence

<dnaseqindica>4099..4206#3785..3877#3393..3448#2980..3086#2642..2843#2326..2380#1723..1784#1460..1573#1278..1340#821..830#613..698#71..440#acaacacgacggccgctcgccgatcacacgctgacgcgcacacaccggcgatttctcagccgcaatcgccatggccaccgccaccgccacctccctcgcctcctccgccgcgcaccgccgcctcccgccctcgcgctcagccgctagctccatcctgagagcccccaaccggggccgcctctgccccggctccccgtcggtgctccgcgcgtcgtcctcgtctccgtcgtctccccagcccaccgccggcggtgatgagggggaggaggaggaggaggggcggaggctgtcgaagcagtcgtcgtgggaggcgaaggactccgagggggatgactacctctaccgcctcgggaaggaggccgacaacatgaacatcgccgtcggcgcgcggagcggcatcgtcgacgacctcttcgtcggcaacttcctcggcaaagactgtacgcgctccagcacttggatgccccgttcgatccaaataccatcttataataaaatgtcctgaattgtttggttcctgaacatgagattctgtatactaacttcagcagtagacgatctttccttggttacagctctatatatatagttacttgtgaaatgtgtttgcagcggatattgtgttcgattaccggcagaaagcgaccaggacgtttgagtacctgcaaggagattattacatcgcacccctcttccttgtgagtgtaattttagttcatcttcagctgatctttttttttttactgcatcctcgtacttttatgctgttctaggtacctgattgacaaagatttgacactgcagattcgttgtggtgcaggataaagttggtaagcaatttaatgtaggaggaagcacattgttataatcaggtatctcactcttacagtttgaagagactacatctttcgtttcacctgcataaacagtggctactgaagtatcagtgtccttctgtataagaaactgaacaagttatacaaaggtgtaacagttgccgaataagcttaccaccatataccaacagtccctagaggcctagactgaatatatatatttttgggtcaaactatcaaataatggcatgcaatgttggcagcatgtgaaatatatgcaaatcttacatttacattaattgtgattatgctaaactcttccttaataatatcttgaacttttatatggtatatattcttgtggctatagtgtgcatgacaaatttattttattctttttctccaggcacacatactaaaaggactgcttgatgtttgcagcatgtcatattgtgaagaactaccttgcacatattcttactatcaagattccccttatacttggtagtgcacttctctttgtttctctctgtgtaattgggatatgaaataatacatggttgtagttcaatattattctttagttcgttttcaatatttttgaggaacattgcacaatgcaggaatctggggtggaaaaggccaagggaaaacattccagactgaacttatatttagagcaatgggtgttgaacctgttattatgtctgctggagaactagaatctgagaaagcaggtcaaagacacttgaatttgtgcttactgtttacatgctttatgtactctgctatattttgcaaggttgctatcaatgtggtgctccgtagatcatcaaagggtctcacgttcattagtttctcatgtgtgtttctgctattgttgcaggagaacctgggaggcttatacgtgaccgatacaggacggcttctcaagtaattcaaaaccaagtaagcaggtgttttcggctactcagtttcagatatgtaccttcaaattcagttctcagttttgagcacaaaacaaaataatgtctcaatttttaaaacttgagtgttatttcacctgtttgagttttttttttttggtatgtgtggaaagctccagtatctgactagcttcgtaattgacacttgaaatcataaaaaaagattgtcgaaaattctattactactgtcactcagttctgaatatggcaaaaatgctccttacatattttagttttctattaccatcttttcaaacagctgattcaatatttggtgtttcctttttcttttttatacatcaagatagcgcaaatgttcctgaatgacttgatgcttgtccgttatgagaaatacaagtgctctcaactctgtagtgctttactcttctgtgttattactgtattatcatgataaagttaacagattaatgatgcctgtgggttttgttaattttcagtttacttcaatgattcctgttttcacaatttttttcatggtataggggaaaatgagtgttttgatgatcaatgacctagatgctggtgttggaagatttggtaagttttgtaaacatattttgtatggtaattgttgatcacagtgacctaggatattttgtttatgcttcctttttgagagcctgtcaacaatactacaatagtgtattcatctggtgtattaattattttccaaatattcttcagaagaagagcaccttttgtaggaagagatggatcttagagttttatttttcatcgaacatatggtgatttctttttgacagcaaactaagtgctatatatcaccgttgttttcaggtaacacacaaatgacagtaaataatcaaattgtgattggaactttaatgaacttggcggataatccaaccagggttagcattggccagaaatggagagaatctgatgtaacacacagagtgccaataatagttaccggaaatgatttttcgacactgtatgctcccttgattcgtgatgggaggatggaaaagttctattggtatgttcgttcttgcatctgaataaattttgttgcaacaaagtacagactgaattttatttgcaacaactagtcggatttaatttggcaaaaaaacttcaaagaatgatacttgaatgtgatatgtgattaataggcagcctggccgtgaagatataattaacattgttcaccgcatgtatataaaggatggtttgtctttcgaggatgtatcaaaagttgtagacacttttccaaaccaaggtaaccatttctccagaactgtaatttcattttgcagcatatgaaacaaggtctatgtttctttttatacaaacatacttagatgatatgtagggaaaagaaaaatagaagaggaactagaacagtaacatagccatcattccctcaagcaaaatacctattctttttttccttttctcaaacttcattattttccttgttcagttgctggtggaaactagttattattattatttagcatagaaagtatccatttttcaactacatttgaaaagtatattcaagagcgaactcaacccactgcagctctggacttttatggagctttgagatccaggacatacgatcgggcaatcttgcaggtacctgtgttgatttaggacagagttcgcaattctattttccagttcgttttagaaaaaaaattcacctgattttttgtatgtgaaacaatgtcatgtctgttactctgtttagttgttgaagatgtacttttttgcaaatactgttgaagatgtactggtgtgcaccaaacagcgtgtatggagacagcgtgcaccaaacaacttgacaagcagacaatttttttccaaaaagttttaacagttgtatttccgataaatgtaccattagggtagtagttactgtattgtacttcagacatacttttctgtaaactggaaatctcctgggtgcagtgggtagaagagattggtggtcatgaacaactaaatgaaaagcttctcaagcgaaagaaaggagaggagcttccaacatttattcctccaaaggtattcagtttttcaggccacataactggcttgcgttgtactgagatttctttgtcataatcagtttgctaaatgtctttccctaaaaaaaaagtctgctaaatgtcaaaacagcaagctcacatactgattcttcattactctactgaatatcatctaagtagtaattgttgtttctttcattgatatgtataatatcctgatgttattttgttcatcagaccactgtagatgcgttgattgaatctggggactctctggtgaaagagcaagaactgataatgaattcgaaactgtcaaaagaatatatgaagaatttagatgattagttcaaaacaaaaggtctaatagagaaagtactcgaggtgcctatctcaacccgattttgtatatttttgcatctctgaaaactgcacctttctttctctctctctttggtgcccctgcatcctacattctacagaacagttgcatgtgcaagtatacgatagtgtataaaagaacatgaaaaggtatacaagaattttttcggctgtgttttatgtattttagatatctttatataatcgtttgtacaatggtttgcaactctgaactatatataatgaacttcatatattatagt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0658300, RefSeq:Os04g0658300