Difference between revisions of "Os05g0112000"
(→Evolution) |
|||
| Line 28: | Line 28: | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | <ref name="ref1">Austin, M.J., Muskett, P., Kahn, K., Feys, B.J., Jones, J.D., and Parker, J.E. (2002). Regulatory role of SGT1 in early R gene-mediated | ||
| + | plant defenses. Science 295, 2077–2080.</ref> | ||
| + | <ref name="ref2">Liu, G.Z., Pi, L.-Y., Walker, J.C., Ronald, P.C., and Song, W.-Y.(2002b). Biochemical characterization of the kinase domain of the rice | ||
| + | disease resistance receptor-like kinase XA21. J. Biol. Chem. 277, 20264–20269.</ref> | ||
| + | <ref name="ref3">Park CJ, Peng Y, Chen X, Dardick C, Ruan D, et al. (2008) Rice XB15, a protein phosphatase 2C, negatively regulates cell death and XA21- mediated innate immunity. PLoS Biol 6: e231.</ref> | ||
| + | <ref name="ref4">Jiang Y, Chen X, Ding X, Wang Y, Chen Q, et al. (2012) The XA21 binding protein XB25 is required for maintaining XA21-mediated disease resistance. Plant J. doi: 10.1111/tpj.12076.</ref> | ||
| + | <ref name="ref5">Nodzon LA, Xu WH, Wang Y, Pi LY, Chakrabarty PK, et al. (2004) The ubiquitin ligase XBAT32 regulates lateral root development in Arabidopsis. Plant J 40: 996–1006.</ref> | ||
| + | <ref name="ref6">Goodin MM, Zaitlin D, Naidu RA, Lommel SA (2008) Nicotiana benthamiana: its history and future as a model for plant-pathogen interactions. Mol Plant Microbe Interact 21: 1015–1026.</ref> | ||
| + | <ref name="ref7">Xu, W.H., Wang, Y., Liu, G., Chen, X., Tinjuangjun, P., Pi, L.Y., Zhang, Y., and Song, W.Y. (2006). The autophosphorylated Ser686, Thr688 | ||
| + | and Ser689 residues within a putative protease cleavage motif in the juxtamembrane domain of XA21 are implicated in the stability control of the rice receptor-like kinase. Plant J. 45, 740–751.</ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 14:43, 8 June 2014
Os05g0107700, named as xb3, is a recessive gene associated with resistance to rice bacterial leaf blight.
Contents
Annotated Information
Function
The receptor kinase XA21 confers resistance to bacterial blight disease of rice (Oryza sativa) caused by Xanthomonas oryzae pv. oryzae (Xoo).The XA21 binding protein 3 (XB3) is capable of inducing cell death when overexpressed in Nicotiana benthamiana. XB3 is a RING finger-containing E3 ubiquitin ligase that has been positively implicated in XA21-mediated resistance. Mutation abolishing the XB3 E3 activity also eliminates its ability to induce cell death. Phylogenetic analysis of XB3-related sequences suggests a family of proteins (XB3 family) with members from diverse plant species. Members of the XB3 family from rice, Arabidopsis and citrus all trigger a similar cell death response in Nicotiana benthamiana, suggesting an evolutionarily conserved role for these proteins in regulating programmed cell death in the plant kingdom.
Expression
XB3 is a member of a highly conserved E3 ubiquitin ligase family. Overexpression of XB3 or other members of this E3 family from rice, Arabidopsis, and citrus induces a cell death response in N. benthamiana.
Evolution
A total of 58 proteins were identified from diverse plant species ranging from rice and Arabidopsis (annual) to woody citrus (perennial). All of the identified sequences share similar ankyrin-RING structures. Phylogenetic analysis revealed that 34 out of the 58 identified proteins, including XB3, form a large group with two major subclades that differentiate sequences from dicotyledonous and monocotyledonous plants (Figure 1). This group of proteins was apparently more related to XB3, and therefore named the XB3 family. The copy number of the XB3 family members varies among plant species. For instance, rice contains three members, XB3, XBOS31 and XBOS37, whereas Arabidopsis carries only one, XBAT31. In the newly sequenced citrus genome, there are two XB3 family members, XBCT31 and XBCT32. The XB3 family is phylogenetically distinct from XBAT32, an ankyrin-RING protein that has been implicated in lateral root development.
Phylogenetic analysis of the XB3 family.
Knowledge Extension
The demonstration of the XA21–XB3 interaction in vivo may be generally important for understanding RLK complexes in rice and in other plants. In a large-scale yeast two-hybrid analysis, nine of 50 randomly chosen rice RLKs interact with four putative E3 ubiquitin ligases). In Brassica napus, the PUB-ARM protein ARC1 interacts with the kinase domain of the S receptor kinase in the yeast two-hybrid system and in vitro. ARC1 is positively involved in the self-incompatibility system . It has been proposed that ARC1 promotes the ubiquitination and proteasomal degradation of compatibility factors in the pistil. In tobacco (Nicotiana tabacum), the Nt PUB4 protein is also a member of the PUB-ARM family. Yeast two-hybrid analysis has linked Nt PUB4 to the kinase domain of the chitinase-related RLK CHRK1 that may be involved in development and cytokinin homeostasis. Thus, many plant RLKs may interact with E3 ubiquitin ligases. When Xb3 is reduced, resistance to Xoo PR6 is compromised in the Xa21 lines. The compromised resistance can be attributed to a decrease in the level of the XA21 protein. The dosage effects have been suggested by several previous studies. Additionally, the heterozygous Xa21 plants generated by a cross between 4021-3 and TP309 are slightly less resistant than the homozygous plant 4021-3. Alternatively, but not mutually exclusive, the reduction of Xb3 may directly contribute to the compromised resistance as well. In this case, the XB3 level is a rate-limiting step for Xa21-mediated resistance.
Labs working on this gene
- Department of Plant Pathology, University of Florida, Gainesville, Florida
- Department of Agronomy, Louisiana State University, Baton Rouge, Louisiana
- Department of Plant Pathology, University of California, Davis, California
- Department of Crop Science, North Carolina State University, Raleigh, North Carolina
- Plant Molecular and Cellular Biology Program, University of Florida, Gainesville, Florida
- Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China
References
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Structured Information
| Gene Name |
Os05g0112000 |
|---|---|
| Description |
Zinc finger, RING-type domain containing protein |
| Version |
NM_001060984.1 GI:115461698 GeneID:4337598 |
| Length |
3751 bp |
| Definition |
Oryza sativa Japonica Group Os05g0112000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:617592..621342 |
| Sequence Coding Region |
618924..619328,619454..619715,620011..620118,620232..620372,620470..620591 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:617592..621342 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:617592..621342 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgggtcacggtgtcagctgcgcccgcaccggcgacgagcacgacttcttccgggcggcgcagctcggcgacctcgacgccctggccgccctcctcgccgccgacccttccctcgctcgccgcgccaccctctacgaccgcctctccgtcctccacatcgccgccgccaatggccgcatcgaggtgctctccatgttcttggatcgcggggcgccgccggacgcggtgaatcggcacaagcagacgccgctgatgctcgcggccatgcacggcaagatcgactgcgtgctcaagctcctccaggccgacgcaaatatcttgatgttcgactcggtgcacgcgaggacctgcctccaccacgcggcgtactacggccacgtcgactgcctgcaggccatcctcgccgccgcgcagaccacgccggtggccgactcatggggtttcgcccggttcgtcaacgtcagggacgaccacggcgccactccgctgcatctcgcggccaggcaggggcggccggggtgcgtgcaggtgttgctggagaacggcgccattgtgtcggctttgacaggatcatatggcttccctggaagcacgtcgcttcatttggctgctcgtagcgggaacttggattgcatcaggaagctgcttgcctggggagctgatcggctccaaagggattcggctgggagaattccctattctgttgcgctgaaacggaaccatggagcatgtgcagctttgctgaaccctacatcagcagagcccatggtgtggccatccccacttaagttcatcagtgagcttgaaccagaagctaaggctctcctggaagcagctctgatggaagccaacagggagagggagaagaaaatcctgaatggcacaaagtactccctgccatccccttcgcccggtgatgacagtgccgatgacgatgcatgctcagaggtgagcgacacggagctttgctgcatctgcttcgaccaggcttgcaccattgaggtgcaagactgtggacatcaaatgtgtgcaccgtgcacgctggcactgtgctgtcacaacaaacccaatccgacgaccctgacaccgccctcaccggcctgcccattctgccggggcagcatctcacggctggtggtggcccaaacaaggtctgcttgtgatcctgacaagccgtcatccctgcagctcacccggaagcggtcgcgtcgatctcacaacctcagtgagggcagcagcagcttcaaagggctaccttcggccatgggctccttctcaaagcttggccgtggctcgagccgcatggcggacagtgacagcagcaacctggacaagcctgagcacgatctatga</cdnaseq> |
| Protein Sequence |
<aaseq>MGHGVSCARTGDEHDFFRAAQLGDLDALAALLAADPSLARRATL YDRLSVLHIAAANGRIEVLSMFLDRGAPPDAVNRHKQTPLMLAAMHGKIDCVLKLLQA DANILMFDSVHARTCLHHAAYYGHVDCLQAILAAAQTTPVADSWGFARFVNVRDDHGA TPLHLAARQGRPGCVQVLLENGAIVSALTGSYGFPGSTSLHLAARSGNLDCIRKLLAW GADRLQRDSAGRIPYSVALKRNHGACAALLNPTSAEPMVWPSPLKFISELEPEAKALL EAALMEANREREKKILNGTKYSLPSPSPGDDSADDDACSEVSDTELCCICFDQACTIE VQDCGHQMCAPCTLALCCHNKPNPTTLTPPSPACPFCRGSISRLVVAQTRSACDPDKP SSLQLTRKRSRRSHNLSEGSSSFKGLPSAMGSFSKLGRGSSRMADSDSSNLDKPEHDL </aaseq> |
| Gene Sequence |
<dnaseqindica>2015..2419#1628..1889#1225..1332#971..1111#752..873#590..661#366..425#82..264#attctcactctcggccttccttccacggcagcgccacccactgcgccttcgccggcggcggaggaggagggaggtgcggccatgggtcacggtgtcagctgcgcccgcaccggcgacgagcacgacttcttccgggcggcgcagctcggcgacctcgacgccctggccgccctcctcgccgccgacccttccctcgctcgccgcgccaccctctacgaccgcctctccgtcctccacatcgccgccgccaatggccgcatcgaggtcgctcacctcactgcttcttcttcttcttcttccctcggtctccgggacttgcttgtctcaccctttctctcttgttttctttcttcttcttcttccaggtgctctccatgttcttggatcgcggggcgccgccggacgcggtgaatcggcacaagcaggtgcgagatccccaccaaaatctctcttcttttttgctactgtttttcgaattactagtatctgcttgaaaatatcatattttgattttgaatgaaaaagaaagatctcgtcttgtccttttgttttctcaccttgctttgctcttcttctgcttatgctgcagacgccgctgatgctcgcggccatgcacggcaagatcgactgcgtgctcaagctcctccaggccgacgcaaatgtgagagaaaagaactgcaaaatcagtatactgataatactgtagtaattctgtttgaaaaaatcagtaacagttacgatttcgcaccagatcttgatgttcgactcggtgcacgcgaggacctgcctccaccacgcggcgtactacggccacgtcgactgcctgcaggccatcctcgccgccgcgcagaccacgccggtggccgactcatggtgagatcatcctcatcctgtcgtgtggctttggtacagctatagaatagctctggatgtctctgtgagctcacttgctgctgtcgaagcttggcaggggtttcgcccggttcgtcaacgtcagggacgaccacggcgccactccgctgcatctcgcggccaggcaggggcggccggggtgcgtgcaggtgttgctggagaacggcgccattgtgtcggctttgacaggatcatatgggtaatgctgctgatcttggtggcatcccaaattaatgtttggtgatcagctgttcagctctgttggttccttgctaccagtgctgattcgtgtggtggtgttgtttgatgcagcttccctggaagcacgtcgcttcatttggctgctcgtagcgggaacttggattgcatcaggaagctgcttgcctggggagctgatcggctccaaagggattcggctgggtgagaactagatctttcccccttcagtttttgtcttggcgcatatagaagaaaacattgatgtgctatcaagcatagttgttagtgaagttcaggtgttgaatttaggtgcttagtagaatccctgcagttcttagacagtagacctcagtctagcaagtagtaacaggtgaactcgctgaccatttgctgaattcacatgagcttgctgttcttctcaaacttgacctgtccttttgctgaattgcccatgctctgccactgattttaattttaatggtttttgtttccccaggagaattccctattctgttgcgctgaaacggaaccatggagcatgtgcagctttgctgaaccctacatcagcagagcccatggtgtggccatccccacttaagttcatcagtgagcttgaaccagaagctaaggctctcctggaagcagctctgatggaagccaacagggagagggagaagaaaatcctgaatggcacaaagtactccctgccatccccttcgcccggtgatgacagtgccgatgacgatgcatgctcagaggtatttgagtgctgaacaatttcagtgttatctgtcagattgggatcccataaacacattgtgtaatttagctttctgtgcatttgcatgatgactgaatggctgtgttgatcatttgggcacaggtgagcgacacggagctttgctgcatctgcttcgaccaggcttgcaccattgaggtgcaagactgtggacatcaaatgtgtgcaccgtgcacgctggcactgtgctgtcacaacaaacccaatccgacgaccctgacaccgccctcaccggcctgcccattctgccggggcagcatctcacggctggtggtggcccaaacaaggtctgcttgtgatcctgacaagccgtcatccctgcagctcacccggaagcggtcgcgtcgatctcacaacctcagtgagggcagcagcagcttcaaagggctaccttcggccatgggctccttctcaaagcttggccgtggctcgagccgcatggcggacagtgacagcagcaacctggacaagcctgagcacgatctatgaaagcagaacaacgcacggacaatcgccgcatcatcctcaaaacatccgttggtatcagaaacccagatgaaaatccaatggctaatttggagcaactttgatccatggaaagttaaatagatagggactaaataagtagaaccctccactccccattgtctgtgtgcccaccctatttttcggcttgccgggttaagcttagcatatgcataggagctctgaaagaccagagagagagtgagtgagtgagtgagagcaattcatcatcaatcacacagtgagtgttggtgtggttaagggatgcatgcagcagagatgtgaaacggggttcatgttcgtcacctctaaagttagcctgccatggcatgtgagctctgcgccggcctgacccctcctcctctgtgtgatgaatcatgcccccatttttggcccttgtctcgtgttataatggtgcgagttcatgtcctggtgatgctgcagccatcagcagggtggtccattggatcgccatgaattcagcagctgcggtctctgcctatgtgatgacattgtatgtaccgtactccagtgtgtaccggttctttgaactgtggtggcgtgtcactgtctctgtcagtgccactgtccatcgtcgtccggctgttacagccggattgttactgctagtaattggcttccttcgttcgttcgtgatggcatcagcatcagattgtttcttttcttcaggctgataaaatgaagactgttgttgcctgtagctgtatggttgtccttgcgatctgtaccttctcttgtgctcctacctgcagtgatattgtgagatccaggagtagcataatttttctatcgacaaatcataccactacatttcacttggaaagatggacttagcatcataggtttaggtgagactgaggaccaactctgattaacactgaagtctgccgtgtggattgggtttagattgaaagaaattcatggagataacaagaatttttgtggcaaaagctttgttgttatgcagagtttaaggactaggagatgactatatgagacacaagccaagtgctactgtagtttgttttgaccaggacacagcacacaacttggaatttggaaaccttccaagtcatggctgcaattccacgtcaggcttggtgatcgacctagtagttcttttgcttcttgtgacgaactgacgataacacggacagatatttgtgaagctttggccattctatagtccatatgatcactcaagcaaaaaatatcttggtgccacacctcatcatgtgacagaaactaactaataatttcaaagtgcgattaatt</dnaseqindica> |
| External Link(s) |
