Difference between revisions of "Os06g0157500"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File:FigureYL1.jpg|right|thumb|250px|'''Figure 1.''' ''Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference<ref name="ref1" />).'']]
 
+
FLOWERING LOCUS T 1 (RFT1) is a florigen gene in rice (Figure 1), because an RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions(Figure 2). RFT1 is the closest homolog to Heading date 3a (Hd3a) and is a major floral activator under LD conditions. Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.RFT1 and Hd3a regulate rice flowering under LD and SD conditions. The OsMADS50-Ehd1-RFT1 pathway is involved in floral activation under LD conditions.RFT1 encodes a major LD florigen. OsMADS14 and OsMADS15 act downstream of RFT1 in the SAM under LD conditions.
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 18:05, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Figure 1. Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference[1]).

FLOWERING LOCUS T 1 (RFT1) is a florigen gene in rice (Figure 1), because an RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions(Figure 2). RFT1 is the closest homolog to Heading date 3a (Hd3a) and is a major floral activator under LD conditions. Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.RFT1 and Hd3a regulate rice flowering under LD and SD conditions. The OsMADS50-Ehd1-RFT1 pathway is involved in floral activation under LD conditions.RFT1 encodes a major LD florigen. OsMADS14 and OsMADS15 act downstream of RFT1 in the SAM under LD conditions.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0157500

Description

Similar to CiFT protein

Version

NM_001063394.1 GI:115466519 GeneID:4340184

Length

1652 bp

Definition

Oryza sativa Japonica Group Os06g0157500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:2925824..2927475

Sequence Coding Region

2926081..2926284,2926432..2926493,2926607..2926647,2927174..2927403

Expression

GEO Profiles:Os06g0157500

Genome Context

<gbrowseImage1> name=NC_008399:2925824..2927475 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:2925824..2927475 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggcagcggcagggacgatcctcttgtggttggcaggattgtgggtgatgtgctggatccattcgtccggatcactaacctcagtgtcagctatggtgcaaggatcgtctccaatggctgcgagctcaagccgtccatggtgacccaacagcccagggtcgtggtcggtggcaatgacatgaggacgttctacacactcgtgatggtagacccggatgctccgagcccaagcaaccctaaccttagggagtatctacactggctggtcaccgatattcctggtaccactggagcaacatttgggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacggtgtacgcaccggggtggcgccagaacttcagcaccaggaacttcgccgagctctacaacctcggctcgccggtcgccaccgtctacttcaactgccagcgcgaggccggctccggcggcaggagggtctacccctag</cdnaseq>

Protein Sequence

<aaseq>MAGSGRDDPLVVGRIVGDVLDPFVRITNLSVSYGARIVSNGCEL KPSMVTQQPRVVVGGNDMRTFYTLVMVDPDAPSPSNPNLREYLHWLVTDIPGTTGATF GQEVMCYESPRPTMGIHRLVFVLFQQLGRQTVYAPGWRQNFSTRNFAELYNLGSPVAT VYFNCQREAGSGGRRVYP</aaseq>

Gene Sequence

<dnaseqindica>258..461#609..670#784..824#1351..1580#cctgtcactgtttggctagcttaaccttcctgacatctatcctctggattgaacggcaggagatacctaagctagctagcaatctctatcgatctgtttgtttacatgttcagttaaaggttactgagaaatgcctagagtttttccggctagcttcataagttagtgggttagctgacctagattcaaagtctaatccttttatttatttgatattagatatcctaacgtttttagttagaggttattaatttgacatggccggcagcggcagggacgatcctcttgtggttggcaggattgtgggtgatgtgctggatccattcgtccggatcactaacctcagtgtcagctatggtgcaaggatcgtctccaatggctgcgagctcaagccgtccatggtgacccaacagcccagggtcgtggtcggtggcaatgacatgaggacgttctacacactcgtacggatcatatcttggatgcagagacccaccagaagttatttaattactttcattaattatcataaaactagactataaattatattttttacatggatgcatgttaattttgtgtggcttacgtactaatctaattacctacaggtgatggtagacccggatgctccgagcccaagcaaccctaaccttagggagtatctacactggtaggcaccgatcagatatgttagctagctaattgtatacattcgtcctagaatataaagaatttggaccggattctcaatcattcgcgttgattctctttgtctgtctgtaggctggtcaccgatattcctggtaccactggagcaacatttggtcagtaaactagtatatatatatagtactcatatcaatttcgatgtaacagcaacatatgtggcagttccatgaatttttattaccttggtcctaccccatatatatacttcaaaaattgcataatgacaaaattatactccctccgtattttaatgtatgacgccgttgactttttaaccaacatttgaccattcgtcttatttaaattttttatgcaaatacaaaaatacttatgtcatgcttaaagaacatttgatgataaatcaagtcacaataaaataaatgataattacataatttttttgaataagacaaaaagtcaaacgtttgttaaaaagtcaatgtcgtcatacattaaaatacggagggagtatctattttgtcaaaaattttcgtcagatttgaaggatagggctgtacttcttctatgccaaaatggagggtggtgatcccctcaaaacttgtagaacagccactgttgatatatatatggtgaataacgtagataattaaattgatgcagggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacggtgtacgcaccggggtggcgccagaacttcagcaccaggaacttcgccgagctctacaacctcggctcgccggtcgccaccgtctacttcaactgccagcgcgaggccggctccggcggcaggagggtctacccctagctagctacgcatgccacccggcctccatgcatgcagcagctatagctaagctgagacctgcctagctgtata</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0157500, RefSeq:Os06g0157500

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1