Difference between revisions of "Os06g0125800"
Xingruxiao (talk | contribs) (→Function) |
Xingruxiao (talk | contribs) (→Expression) |
||
| Line 11: | Line 11: | ||
===Expression=== | ===Expression=== | ||
| − | + | 1. OsBBI1 is induced by BTH and M. oryzae | |
| + | The expression of OsBBI1 was induced by rice blast fungus Magnaporthe oryzae, as well as chemical inducers, benzothiadiazole and salicylic acid, and it encodes a RING protein with E3 Ubi ligase activity in vitro. Expression of OsBBI1 was induced in M. oryzae-infected plants within a period of 48 h, and reached the peak at 24 h after inoculation (Figure 1A). OsBBI1was upregulated by BTH and SA treatment and reached the peak at 12 h (BTH) or at 24 h (SA) after treatment, respectively; but was not inducible by JA and Xoo infection (Figure 1B) | ||
| + | |||
| + | 2. OsBBI1 encodes a RING protein with E3 ligase activity | ||
| + | The OsBBI1 gene encodes a 261-aa protein, which contains a conserved RING domain at the C-terminal end. To confirm whether the OsBBI1 protein has E3 Ubi ligase activity, we expressed full-length OsBBI1 as a six His-tagged fusion protein (His-OsBBI1) in Escherichia coli and purified the recombinant protein for enzyme activity assay (Figure 7). | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 00:50, 9 June 2014
OsBBI1, which encoding a RING finger protein with E3 ligase activity, mediates broad-spectrum disease resistance.
Contents
Annotated Information
Function
1.OsBBI1 modulates broad-spectrum resistance to blast fungus by modifying cell wall defence responses. Disease lesions on the osbbi1 leaves were significantly larger than on the WT leaves after inoculation with two races of M. oryzae. These results indicate that OsBBI1 is required for full immunity in rice against M. oryzae.
2.The functional characterization of OsBBI1 provides insight into the E3 ligase-mediated innate immunity, and a practical tool for constructing broad-spectrum resistance against the most destructive disease in rice. The level of protein ubiquitination increased with incubation time, indicating the E3 ligase activity of His-OsBBI1 (Figure 7B). In the presence of Ubi, E1, and E2 enzymes, His-OsBBI1 could carry out self-ubiquitination, while no clear protein ubiquitination was detected in the absence of E1, E2, or HisOsBBI1 (Figure 7C). The truncated mutant, OsBBI1 ∆RING ligase, and the RING domain in OsBBI1 is essential to its E3 Ubi ligase activity.
3.Enhancement of cell wall defence response in OsBBI1 overexpression plants The percentages of autofluorescent cell walls and cross-linking increased by ~10% in the OsBBI1-OE plants compared with that in the WT plants at 24 h.p.i. This increase was much more significant at 48 h.p.i. (Figure 5B and 5D). In contrast, the percentages of autofluorescent cell walls and cross-linking of wall-associated proteins at infection sites were lower in the osbbi1 plants than those in the WT plants at 24 and 48 h.p.i. (Figure 5E and 5F).
Expression
1. OsBBI1 is induced by BTH and M. oryzae The expression of OsBBI1 was induced by rice blast fungus Magnaporthe oryzae, as well as chemical inducers, benzothiadiazole and salicylic acid, and it encodes a RING protein with E3 Ubi ligase activity in vitro. Expression of OsBBI1 was induced in M. oryzae-infected plants within a period of 48 h, and reached the peak at 24 h after inoculation (Figure 1A). OsBBI1was upregulated by BTH and SA treatment and reached the peak at 12 h (BTH) or at 24 h (SA) after treatment, respectively; but was not inducible by JA and Xoo infection (Figure 1B)
2. OsBBI1 encodes a RING protein with E3 ligase activity The OsBBI1 gene encodes a 261-aa protein, which contains a conserved RING domain at the C-terminal end. To confirm whether the OsBBI1 protein has E3 Ubi ligase activity, we expressed full-length OsBBI1 as a six His-tagged fusion protein (His-OsBBI1) in Escherichia coli and purified the recombinant protein for enzyme activity assay (Figure 7).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0125800 |
|---|---|
| Description |
Zinc finger, RING-type domain containing protein |
| Version |
NM_001063188.1 GI:115466107 GeneID:4339966 |
| Length |
2362 bp |
| Definition |
Oryza sativa Japonica Group Os06g0125800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:1382622..1384983 |
| Sequence Coding Region |
1383074..1383223,1383430..1383673,1383792..1383859,1384044..1384091,1384188..1384312 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:1382622..1384983 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:1382622..1384983 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccaccgtggggcagcctgatgccatgagaaggatcaccgttcactacgtgaatccgccgccgatcgccggcgccggagaagcacacgtcgatggcctcgacgacgaggttcttgattatgtgattggtgatgttcttcaggatcaggagggtctgtatcaatcgatattgtatggcaaatacggggatgacatgagaggggcaagaaacactgctcttgcccaatctgatggtttacattactactatcacggagagaacagcagtggtgaagcaacaacctcgagaaattcagaaatcgaccaacagattgagtatgacttggtgttcgctaggcagctgcaggcaatggataatctgacaattgagacacctgcagatgaagatgatgatataagctgcgtaccctctccatctgactctgaaaccgatgaaccggcagaaggcaacaacgaagaggctgccacacaggatgataacgatgatccagacaacatgacatacgagcaaaggcaggcacttgtggaatctgtaggaaatgagaacagaggtttatctgatctgcttatctcctacttggagacatggaagtacaaatcaggctttttcccaaggaaggcaaaccatgataactgtcctatatgtctatccgctttcagacgccgagaaacactcattacattggcttgcaagcatagttaccatgaaggttgtattgctagatggctcaagattgacaaggcctgcccagtttgcaaatatgaagtgtttggaccttcctag</cdnaseq> |
| Protein Sequence |
<aaseq>MATVGQPDAMRRITVHYVNPPPIAGAGEAHVDGLDDEVLDYVIG DVLQDQEGLYQSILYGKYGDDMRGARNTALAQSDGLHYYYHGENSSGEATTSRNSEID QQIEYDLVFARQLQAMDNLTIETPADEDDDISCVPSPSDSETDEPAEGNNEEAATQDD NDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLS AFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFGPS</aaseq> |
| Gene Sequence |
<dnaseqindica>453..602#809..1052#1171..1238#1423..1470#1567..1691#1840..1948#2164..2205#aacaaagaatccgtccagccttgagaagcagagaagaggagagaaacaagagacagacagacagagatagagtaactgagtaagcatctcgatcttggcatgttctttcttcttcccctttcccttcattgattctcctcttgttttcctcatcacaaactcctgcagagacctgttcttcacctcaattctgctcttgttatattgcctggattcctttttttttttggttcttggaagcttctattgccgctgcttgttcttgagtgccctctgcaatttatagataattttcttcagtttttttatccaaaaagagttcttggattagttgtaaagaagaggttaaatcaaggaaggttgcatcttgttcttgactgattaattggtgtgccatgatctgcaggtaaacgggttcttgcctgacatttgtcttgtccgggtggccattcatggccaccgtggggcagcctgatgccatgagaaggatcaccgttcactacgtgaatccgccgccgatcgccggcgccggagaagcacacgtcgatggcctcgacgacgaggttcttgattatgtgattggtgatgttcttcaggatcaggtatgcatttgatccaacctttccatcattattagcatactgctcttacaggcttgcagaatgatgagctttagcatcaaacatatgtttctaagcctttgatatggcctctttactttagttcaacattgtttagtaaactttccactgtttctctgaaacttttttgagaataaacttatttgtttttctgaacttttttctaggagggtctgtatcaatcgatattgtatggcaaatacggggatgacatgagaggggcaagaaacactgctcttgcccaatctgatggtttacattactactatcacggagagaacagcagtggtgaagcaacaacctcgagaaattcagaaatcgaccaacagattgagtatgacttggtgttcgctaggcagctgcaggcaatggataatctgacaattgagacacctgcagatgaagatgatggtatgcattcattctcgttcagtttttgtaagcacttgatgtgcataatgattttcagtcgtggcaatcttaatcttttcacctctgaaattttgttgcccatgttggtttgattcagatataagctgcgtaccctctccatctgactctgaaaccgatgaaccggcagaaggcaacaacgaagaggtgattatatgagctgtttcagaattgcaattattcagcattgttcgtttcagacttcttgatgcaaagatacacaattgcgtattcactaaaaagatgagctgtttcagaataaagcctttccaaatggataatgtataaacatgtactacgaaaagttgagattcctatcatttgtttgcaggctgccacacaggatgataacgatgatccagacaacatgacatacgaggttagtgttatattcacttgtatcacatttcttctgtaaaagaggtttacaccatctatgaaaaagttgctgattcttattctttctgtaatccagcaaaggcaggcacttgtggaatctgtaggaaatgagaacagaggtttatctgatctgcttatctcctacttggagacatggaagtacaaatcaggctttttcccaaggaaggcaaaccatgataagtatgtctaccatttcagttttcaatcaatcacatactgatttcttgcagaagataatccaagcatgtaactgatgacactctgattaaaatcttcatcatggcatgcaactgatgatttcctcctcttttttctcccaaaattgcagctgtcctatatgtctatccgctttcagacgccgagaaacactcattacattggcttgcaagcatagttaccatgaaggttgtattgctagatggctcaagattgacaaggtaaacaccttcttgggacactagatttgctatctgaattgtgtacctatcttagattataccatttgtcaaagtttacatgagcactgatatgcactgtccatttcatataacaagatggtctttgtctttcagtttccttgagcttcttccaaattaaaagaacttcatgggcttgtgcagtggaattcctgacatttttgtttatgaaacaggcctgcccagtttgcaaatatgaagtgtttggaccttcctagcgtgtgaggaggcgatcaacaaggctgaccaactatgactcgatgagacggcatatagtggttgcagcatctgctctgcagtattaattaaaaagggaaaccttaactcccaaaaaaaacagagaagggaagaaaaagaaagcaaaaaggaaaaagg</dnaseqindica> |
| External Link(s) |
