Difference between revisions of "Os10g0397400"
(→Expression) |
(→Expression) |
||
| Line 7: | Line 7: | ||
===Expression=== | ===Expression=== | ||
The ''brd2'' mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type ''Dim/dwf1'' gene into ''brd2'' restored the normal phenotype. Overproduction and repression of ''Dim/dwf1'' resulted in contrasting phenotypes, with repressors mimicking the ''brd2'' phenotype and overproducers having large stature with increased numbers of flowers and seeds. | The ''brd2'' mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type ''Dim/dwf1'' gene into ''brd2'' restored the normal phenotype. Overproduction and repression of ''Dim/dwf1'' resulted in contrasting phenotypes, with repressors mimicking the ''brd2'' phenotype and overproducers having large stature with increased numbers of flowers and seeds. | ||
| + | [[File:figure.png|frame|caption]] | ||
| + | Recently, we identified a dwarf mutant, brd2,which displays the typical BR-deficient phenotype but also has characteristics not observed in the other mutants.Figure 1A shows the gross morphology of the mutant in an early vegetative stage. At this stage, the mutant plant (right) displays a moderate dwarf phenotype with a height 70% of the wild-type plant (left) but no other obvious abnormalities. However, as development progresses, the phenotype becomes more severe with characteristics typical of BR-related mutants: dark-green, erect leaves and shortened leaf sheaths. After flowering, the height of the plant reaches only 40% of the wild type (Figure 1B). We compared the internode elongation patterns of ''brd2'', the wild type, and other BR-deficient mutants (Figure 1C). In the wild type, the five uppermost internodes elongate; the internodes are numbered from top to bottom such that the uppermost, just below the panicle, is designated as the first internode (Figure 1C).By contrast, the three BR-deficient mutants show different elongation patterns:''d2-1'' has a specific inhibition in the second internode,''brd1-1'' is completely defective in internode elongation, and the first internode of ''brd2'' elongates, but the lower internodes do not (Figure 1C).''d61-2'', which is defective in the rice ''Bri1'' gene, also exhibits dwarfism with a lack of internode elongation except for the first internode.The ''brd2'' mutant flowers and produces malformed panicles, but the numbers of spikelets and rachis branches, as well as fertility, are severely reduced (Figure 1D). The lengths of the first and second rachis branches in the panicle are also severely reduced. In contrast with these severe defects, the neck internode of the mutant is longer than that of the wild type (Figure 1D).This phenomenon is a common feature in rice BR-related mutants because long neck internodes are also observed in ''d2'' and ''d61-1''. In addition, the ''brd2'' mutant also exhibits shortened grains (Figure 1E) and defective root elongation and development (Figure 1F). Although one seminal root develops normally during embryogenesis, after germination the seminal root elongates to only two-thirds of the wild-type root and formation of the crown root is inhibited, but lateral root formation is not as severely affected as crown root formation. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 00:57, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The rice (Oryza sativa) brassinosteroid (BR)-deficient dwarf2 (brd2) is a loss-of-function allele of Dim/dwf1, a gene homologous to the Arabidopsis DIM/DWF1.The gene brd2 mutation causes a semidwarf phenotype in the vegetative stage,with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol levels showed that brd2 is defective in the conversion of 24-MC to CR, as are the Arabidopsis dim/dwf1 and pea lkb mutants.
Expression
The brd2 mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type Dim/dwf1 gene into brd2 restored the normal phenotype. Overproduction and repression of Dim/dwf1 resulted in contrasting phenotypes, with repressors mimicking the brd2 phenotype and overproducers having large stature with increased numbers of flowers and seeds.
Recently, we identified a dwarf mutant, brd2,which displays the typical BR-deficient phenotype but also has characteristics not observed in the other mutants.Figure 1A shows the gross morphology of the mutant in an early vegetative stage. At this stage, the mutant plant (right) displays a moderate dwarf phenotype with a height 70% of the wild-type plant (left) but no other obvious abnormalities. However, as development progresses, the phenotype becomes more severe with characteristics typical of BR-related mutants: dark-green, erect leaves and shortened leaf sheaths. After flowering, the height of the plant reaches only 40% of the wild type (Figure 1B). We compared the internode elongation patterns of brd2, the wild type, and other BR-deficient mutants (Figure 1C). In the wild type, the five uppermost internodes elongate; the internodes are numbered from top to bottom such that the uppermost, just below the panicle, is designated as the first internode (Figure 1C).By contrast, the three BR-deficient mutants show different elongation patterns:d2-1 has a specific inhibition in the second internode,brd1-1 is completely defective in internode elongation, and the first internode of brd2 elongates, but the lower internodes do not (Figure 1C).d61-2, which is defective in the rice Bri1 gene, also exhibits dwarfism with a lack of internode elongation except for the first internode.The brd2 mutant flowers and produces malformed panicles, but the numbers of spikelets and rachis branches, as well as fertility, are severely reduced (Figure 1D). The lengths of the first and second rachis branches in the panicle are also severely reduced. In contrast with these severe defects, the neck internode of the mutant is longer than that of the wild type (Figure 1D).This phenomenon is a common feature in rice BR-related mutants because long neck internodes are also observed in d2 and d61-1. In addition, the brd2 mutant also exhibits shortened grains (Figure 1E) and defective root elongation and development (Figure 1F). Although one seminal root develops normally during embryogenesis, after germination the seminal root elongates to only two-thirds of the wild-type root and formation of the crown root is inhibited, but lateral root formation is not as severely affected as crown root formation.
Evolution
The brd2 locus contains a single base deletion in the coding region of Dim/dwf1,a homolog of Arabidopsis thaliana DIMINUTO/DWARF1(DIM/DWF1).It is a knockout allele of Dim/dwf1.
Labs working on this gene
- BioScience and Biotechnology Center,Nagoya University,Chikusa,Nagoya 464-8601,Japan
- RIKEN,Institute of Physical and Chemical Research,Wako-shi,Saitama 351-0198,Japan
- Department of Chemistry,Joetsu University of Education,Joetsu-shi,Niigata 943-8512,Japan
References
- 1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.The Plant Cell,2005,17(8):2243-2254
- 2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.Nucleic Acids Res.36 (DATABASE ISSUE),D1028-D1033(2008)
- 3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.Genome Res.17(2),175-183(2007)
Structured Information
| Gene Name |
Os10g0397400 |
|---|---|
| Description |
Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1) |
| Version |
NM_001071069.1 GI:115481881 GeneID:4348555 |
| Length |
1378 bp |
| Definition |
Oryza sativa Japonica Group Os10g0397400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:13717033..13718410 |
| Sequence Coding Region |
13717336..13717779,13718034..13718408 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:13717033..13718410 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:13717033..13718410 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq> |
| Protein Sequence |
<aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq> |
| Gene Sequence |
<dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica> |
| External Link(s) |
