Difference between revisions of "Os04g0580700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
MADS17 is a member of rice AGL6-like gene. MADS17, caused no morphological abnormalities in the wild-type background, but it enhanced the phenotype in the mfo1 background, so MADS17 has a minor but redundant function with that of MFO1. MADS17 plays minor but redundant roles with MFO1 in floral development and that its minor functions may not be observed unless the function of MFO1 is severely impaired. To further confirm the role of MADS17, introduced the MFO1i+OM17i double-RNAi cassette into mfo1-2. In these mfo1-2–based double-RNAi plants, although the MFO1expression levels were comparable to those in the MFO1i mfo1-2 plants, the MADS17 expression levels were significantly lower than those in MFO1i mfo1-2 plants.
+
MADS17 is a member of rice AGL6-like gene. MADS17, caused no morphological abnormalities in the wild-type background, but it enhanced the phenotype in the mfo1 background, so MADS17 has a minor but redundant function with that of MFO1. MADS17 plays minor but redundant roles with MFO1 in floral development and that its minor functions may not be observed unless the function of MFO1 is severely impaired. To further confirm the role of MADS17, introduced the MFO1i+OM17i double-RNAi cassette into mfo1-2. In these mfo1-2–based double-RNAi plants, although the MFO1expression levels were comparable to those in the MFO1i mfo1-2 plants, the MADS17 expression levels were significantly lower than those in MFO1i mfo1-2 plants.The upregulation of MADS17in the MFO1 knockdown plants suggested that a potential genetic interaction exists between these two genes. Downregulation of MFO1 may have caused a feed-forward regulation of MADS17 expression. Alternatively, the upregulation of MADS17 may result from increased numbers of elongated lodicules and/or abnormal palea, in which MADS17is expressed.
  
 
===Expression===
 
===Expression===

Revision as of 03:03, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

MADS17 is a member of rice AGL6-like gene. MADS17, caused no morphological abnormalities in the wild-type background, but it enhanced the phenotype in the mfo1 background, so MADS17 has a minor but redundant function with that of MFO1. MADS17 plays minor but redundant roles with MFO1 in floral development and that its minor functions may not be observed unless the function of MFO1 is severely impaired. To further confirm the role of MADS17, introduced the MFO1i+OM17i double-RNAi cassette into mfo1-2. In these mfo1-2–based double-RNAi plants, although the MFO1expression levels were comparable to those in the MFO1i mfo1-2 plants, the MADS17 expression levels were significantly lower than those in MFO1i mfo1-2 plants.The upregulation of MADS17in the MFO1 knockdown plants suggested that a potential genetic interaction exists between these two genes. Downregulation of MFO1 may have caused a feed-forward regulation of MADS17 expression. Alternatively, the upregulation of MADS17 may result from increased numbers of elongated lodicules and/or abnormal palea, in which MADS17is expressed.

Expression

RT-PCR analysis revealed that faint expression of MADS17 was detected at the 0.5-mm stage and established after the 1-mm stage.MADS17was expressed in palea, lodicule, and pistil and weakly in empty glumes and stamens, in addition to MFO1. However, in contrast with MFO1, MADS17 was expressed in the lemma. . At stages Sp3–4, when the lemma and palea initiate, MADS17 was expressed in the floral meristem At stage Sp7, MADS17was expressed in the lodicule and palea. In addition, MADS17 was expressed in the lemma, in which MFO1 was not expressed. At stage Sp8, MADS17 was expressed in the receptacle, lodicule, and ovule but not in the mrp. In total, MFO1 was expressed in areas in which morphological abnormalities were observed, and MADS17 expression generally overlapped that of MFO1. the MADS17 transcript levels in both mfo1-2 and MFO1i plants were slightly higher than in the wild type. This observation raises the possibility that upregulated MADS17 masks the effect of the MFO1 knockdown. Therefore, to examine the potential effect of MADS17 on floral development, we generated 16 MADS17 RNAi (OM17i) plants in which the expression of MADS17 was specifically downregulated.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0580700

Description

MADS box transcription factor MADS17

Version

NM_001060184.1 GI:115460097 GeneID:4336762

Length

5870 bp

Definition

Oryza sativa Japonica Group Os04g0580700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:29706752..29712621

Sequence Coding Region

29706874..29707070,29709019..29709103,29709507..29709568,29709654..29709753,29710457..29710498
,29711859..29711900,29712060..29712199,29712287..29712383

Expression

GEO Profiles:Os04g0580700

Genome Context

<gbrowseImage1> name=NC_008397:29706752..29712621 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:29706752..29712621 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatcgatcagagatggggaggggaagggttgagctgaagcgcatcgagaacaagatcaaccggcaggtcaccttctccaagcgccgcaacggcctcctcaagaaggcgtacgagctctccgtgctctgcgacgcggaggtggcgctcatcatcttctccagccgtggcaagctgtacgaattcggtagcgccggaataaacaagacattggaaaagtacaatagttgctgttacaacgctcaaggttcaaatagtgctcttgctggtggtgaacatcagagctggtaccaagagatgtcaaggctcaagactaagcttgaatgtctccaacgctctcagaggcacatgcttggtgaagatcttggaccattgagcataaaggaactgcagcagctggagaagcaacttgagtactcactgtcacaggctcgacaacgaaagacacaaatcatgatggagcaggtcgacgatcttcgccggaaggaacgccagcttggagagctcaataagcaactgaaaaacaagctagaagctgaagccgatagcagcaactgcagatcagccatccaggattcctgggtccatggcaccgtcgtcagtggcggcagagtgctgaatgctcaaccaccaccagatattgactgtgagcctactctgcaaattgggtactatcaatttgtccgtcctgaggcggccaatccaagaagcaatggaggaggaggggatcagaacaacaactttgtgatgggatggcccctctga</cdnaseq>

Protein Sequence

<aaseq>MDRSEMGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLC DAEVALIIFSSRGKLYEFGSAGINKTLEKYNSCCYNAQGSNSALAGGEHQSWYQEMSR LKTKLECLQRSQRHMLGEDLGPLSIKELQQLEKQLEYSLSQARQRKTQIMMEQVDDLR RKERQLGELNKQLKNKLEAEADSSNCRSAIQDSWVHGTVVSGGRVLNAQPPPDIDCEP TLQIGYYQFVRPEAANPRSNGGGGDQNNNFVMGWPL</aaseq>

Gene Sequence

<dnaseqindica>123..319#2268..2352#2756..2817#2903..3002#3706..3747#5108..5149#5309..5448#5536..5632#tagatcatatctcatcccatcatcggtcatattctcctcagcttcatgttgctnagctataggcgaatggttgacaagagtactagttagcttaataatatagctttgcaaaagttgaggnaatggatcgatcagagatggggaggggaagggttgagctgaagcgcatcgagaacaagatcaaccggcaggtcaccttctccaagcgccgcaacggcctcctcaagaaggcgtacgagctctccgtgctctgcgacgcggaggtggcgctcatcatcttctccagccgtggcaagctgtacgaattcggtagcgccgggtaagcgtgtgcatgatccgttcagtaccctaatcgtatgtgattcttgcagatctggtgattaatttctctcttccctttggtttgttttgtttccttccatgggatgcgtattctcgtttgcttcctcagcttaaatccgaaattgtttcttagattttttgttaccaagtatatatatgtgctcgctggtttattttgctatatggttttttgtttctcgctagcgtgcatgtgttttcatacatcttttaggcttaggtaatcttgccggatgtatgcctagctcttgctacttgcatacttgggtaatcttttcataatgaaaatcctccagccctaactcaataaagcacataatatctcttcttcttcttcttcttcagaacctaaagagcattgatttctttcattcgtgcgtgtgcccggcgtgcgcatgtcaggagcagctaggtatatgaggctctgaggcgcaagttttctgattgcaagagtgacttgaaggggaaagtgatggggtctgctgtttccatttagatgccgcaccaagaactttgtttaaatcttttttttcagaattattgcctaatttgatatccatatatttcattcctgcaagtatataacatcttctcttgccatctctcaggtaaattatattacatatgaaccatgcatatgcctctcttttcttttgatgcatttgtgttttcctgaaaggttcgtgttcccgtttaaataaagctttcagatttttttcctgataggtacatgagtttttttttcatttatttgattaaaccctcaaacattatcatcactttagctgcatatatatgaattcgatctttcaaatctcttatgtgtatacgctcttttgcaagattttgtgattctggtattattatttttttcttgttgcattgcctcttgctaatacatgaaggtaaccgagaggggcttatgcacattttgagttgaatgttagtaattgctatatgtattgacgggaaaatcataaatatatatagacgaaaaataactgtgttgattgaaatgcatggatcgaattgaacaccgtttagttgtggaaattcttttatttcttctccggtgatcagtgtgtagggcttctctccagggaccatcagagcaggcgggccatgaaaaaaattttgaataaagtaaatacattacgaaagagttttgtgttattgtgaccggcaactcttgttgctgaacttgctgcttgaacctggtatgcacatgaatatggtggtttttctttttttcatcatagtttattttgcaacatttactttggagtcgccaagaacacacatataaagctttacttagaaatattctttttatttgctaataagtgattcggataagcatatgaataagcgaaacaatgaggctttgtgtccgaattagagcatcattaaacaatttctgaaaacaatttcttcagtagcgatgatcgaaagggattcgttgaactctaacaattattaaaattgttcttgaccacaaattcacctggccatatgattatcattacctattttctgcaattaaatttatgtattttcattctgttatattagtctcctgctgtttaaaattacatatcattctaccttgtcctaatttatgtcaaacatttctatccttgacagtcaatttctagaaatttgtataagttaacaacatgcgaattatatattacaaaagtatttctcatgatgaatctaaaaacataaatcttatgatattaaactatatgaaattttaaattttgatggcaaaacgtacaaatgtttaacttagaacaaaactagaatgcaagtaatttcaaatgcagggcgaagagtagattttattgcattcggctttatgtatgtgagtaagtaacatatcctaaacctatttttgtttgcagaataaacaagacattggaaaagtacaatagttgctgttacaacgctcaaggttcaaatagtgctcttgctggtggtgaacatcaggtattcatagaatagttgtcaaacacacttcggtaaccatattatgtagaatcctttaaagttcaaatatacatatctagacctctttgccagtaatattgtctcaaattcttgagatgcaaggaggatcaatgaagagatatatagtacttaaatattgctgattttaatttgaagattgcaatcaaattctaatatatgtactagttcagtgaataagatattagtacttacattttctaaacctaatgataatatcgcttttttccttgatgcaataaaaattaaacattcagattcatataaaataaaattcaagggtaaataagaacaaaaataaatgcttactattttggattttatcaattattggttttagttttttttcccatttgacccatagagctggtaccaagagatgtcaaggctcaagactaagcttgaatgtctccaacgctctcagaggtactgcactgcatcagctgtttcaggaacacttgaaatgcttcaccacttgaatgtttgggtgttatatttgcatatacaacaggcacatgcttggtgaagatcttggaccattgagcataaaggaactgcagcagctggagaagcaacttgagtactcactgtcacaggctcgacaacgaaaggttatatcaccacacaataaaataagtgtagttccttcaattaccttgttaattaacatacaataatatctgctattatctagtacaatactgtatgcattattctatatatacaacctatatcttgacaaataaaagggatatatactgcaaatatatccatctgatgaattgtaagaaattaaccacttaaggccgtaaatggtgctaaaaaagacaacgcagccgtaatatatataagcaacaaatattgcatgagtgtacgtacttgatcaacaaattttacggcgatctctgctggtagtaggatcaatatctggacctttcatctttacctatccaatatatatttatattactaacttaaccattggtagtagaatattttgtctataggtagtaaaattcataaatcaactgtatataatttctactgataataaaataatatcaataaatatcacaattaataaaagtacttgattgagcaccaagtttatttctataataaaaagacaccataagttttctataattgcttttgcttccttccaacttcggggggacatggtttatatgctcctatgccctgaaatactaaatatgtcagaagaagaagacaacaaagtacagggcttaacttgcatgctcgtccatataaaagttatctaaattttagttgagttctttgtatttatttcagacacaaatcatgatggagcaggtcgacgatcttcgccggaaggtattggaatatctgtcaaatgttgtcgcttttctataaatctgtaacatcgtaattaatcatatgatcaagattactaaaccatatatttgtatgatatgatagcttatcagatctagataattaatcctgaaggttgtggacgtattgctttataattcaatacttgttgcttcagatatggggaatttcaagtgcaccacagagttcgaggacatcaaacattatgctgccattttttcagaatctttcctaaatatttatatatgctttggttattactagggtattccgtgaggaactatatattctctcctttagatgagaatgtatttgttcctgattttactcaatcgtaaaaaaaaaaaggtttatacctaggaaaataaatgtaacaccttataatacagatgcccatctgagtcgctgcgtccgtacctacatttcatacggctttaatgtttatgcgttaatttttcaagttgcaatatggccaccaactattaattaaaaagggatttattttgtcaattatcagaacgaattattgaatcttatcaagaatgaattaattacataccaatattatctatcatgtcacaaaatcattatgatcacaaggagctgtttgcaagacttttagggttaattctttttttcttgctatggctaggggtgatagctgattaaggtccatggatttttttacatccgtatctagcatttgtatatttttagatccagtcttcaaattttatagactaaaaacttgggccaattagcaccctagctgtggctcatatgttgctgcatatactctctttatatatatatatgtgtttgatggtatttacttttaaacataaccattcatattattgaaagaaccgtgcaaatatatagaaatataagtcatgtctaaagtacaaacaaaatggaatagaaggatgaatggtcaaatttatgttaaaaagtcaatggcattagacaaaaaagaaataaagggagtatacatctacctatctagctggaactccaagttctattgtctggaaattggaataggctagctcttgctgacctgtttaactggctttggtggggtgctggtgttccatatgtaatggggatgacattacaccaaaatcgctcagcctttctgcttaatttgcttagtaggagtagtgtagtactcctgaacttgaaccctgtagcatgtcgtttctgataatagaagcgggacagagtgttatgtttttctatcgaaaaaataaaatatagttaatcacatctaataatcctgcctcaaaagtgctagttgtatattccctagttgactgattatctgggctgcctgcaggaacgccagcttggagagctcaataagcaactgaaaaacaaggtcctacttatcgtttccacaattaatttctgcctttcaatttggtggattgggaatactgtacaaccacttctctgttttctagtgttaattagtgtatcttcgaattttgtcatgtcatttcgccatgtagtactaacacatcgccacaccattcagctagaagctgaagccgatagcagcaactgcagatcagccatccaggattcctgggtccatggcaccgtcgtcagtggcggcagagtgctgaatgctcaaccaccaccagatattgactgtgagcctactctgcaaattgggtaagtttggaagatgaatcaaaactaaaacctgatcaatctgatcttccgaaccaacgtgtttgaaaatatgcatgcacgctacaggtactatcaatttgtccgtcctgaggcggccaatccaagaagcaatggaggaggaggggatcagaacaacaactttgtgatgggatggcccctctgaagtccaagcttgctaataaaaacgctggcgtgctataatatatagttcggcaaatgttgaaacacatgtgttctcagtatgtatatttctcccctatccggtggtactcttagcacgtacctatgagtgtatgtttgtacgttatctatactctatgctaggcaaccctatactattatggtaagacgtctatcttttcaatctatctatacgtaccatactaattggcaaattttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0580700, RefSeq:Os04g0580700