Difference between revisions of "Os08g0237000"
(→Expression) |
(→Expression) |
||
| Line 16: | Line 16: | ||
To examine the tissue specificity of OsXTH8, total RNAs from rice callus, root, leaf blade, and leaf sheath were hybridized with OsXTH8-specific DNA probe. A strong signal was detected in leaf sheaths but weak or no signal was observed in leaf blades, roots, and calli (Fig. 4A). These expressions were enhanced by GA3 treatment (Fig. 4A). When 1-month-old seedlings were used to characterize the expression in leaf sheath, the expression was mainly found in the three basal parts of leaf sheath (Fig. 4B). Enhanced expression of OsXTH8 in the third part of 1-month-old rice seedling, which corresponded to the second internode of leaf sheath, compared to two basal parts of leaf sheath showed that OsXTH8 is differentially expressed in leaf sheath. | To examine the tissue specificity of OsXTH8, total RNAs from rice callus, root, leaf blade, and leaf sheath were hybridized with OsXTH8-specific DNA probe. A strong signal was detected in leaf sheaths but weak or no signal was observed in leaf blades, roots, and calli (Fig. 4A). These expressions were enhanced by GA3 treatment (Fig. 4A). When 1-month-old seedlings were used to characterize the expression in leaf sheath, the expression was mainly found in the three basal parts of leaf sheath (Fig. 4B). Enhanced expression of OsXTH8 in the third part of 1-month-old rice seedling, which corresponded to the second internode of leaf sheath, compared to two basal parts of leaf sheath showed that OsXTH8 is differentially expressed in leaf sheath. | ||
| − | |||
| − | |||
===Evolution=== | ===Evolution=== | ||
Revision as of 04:15, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Xyloglucan endotransglucosylases/hydrolases (XTHs) that mediate cleavage and rejoining of the β (1-4)-xyloglucans of the primary cell wall are considered to play an important role in the construction and restructuring of xyloglucan cross-links.OsXTH8 was a single copy gene; its full-length cDNA was 1,298 bp encoding a predicted protein of 290 amino acids.OsXTH8 may play cooperative role with OsXTR1, OsXTR2, OsXTR3, OsXTR4 genes and others that are expressed in overlapping regions. OsXTH8 is involved in cell wall modification processes during rice growth and development.OsXTH8 acts to alter the structure of cell wall in response to gibberellic acid.
Expression
OsXTH8 was preferentially expressed in rice leaf sheath in response to gibberellic acid. OsXTH8 was highly expressed in vascular bundles of leaf sheath and young nodal roots where the cells are actively undergoing elongation and differentiation. OsXTH8 gene expression was up-regulated by gibberellic acid and there was very little effect of other hormones. Reduced accumulation of active GA was accompanied by preferential suppression of OsXTH8 expression, and OsXTH8 expression increased when exogenous GA3 was applied to the semidwarf mutant. In two genetic mutants of rice with abnormal height, the expression of OsXTH8 positively correlated with the height of the mutants. Transgenic rice expressing an RNAi construct of OsXTH8 exhibited repressed growth. These results indicate that OsXTH8 is differentially expressed in rice leaf sheath in relation to gibberellin and potentially involved in cell elongation processes.
OsXTH8 was expressed in growing regions such as shoot apical meristem, vascular bundles of leaf sheath, and young crown roots developing from nodes; thus, OsXTH8 exhibited a unique expression pattern in terms of organ and stage specificity during leaf sheath elongation and young nodal root development. The expression of OsXTH8 in the shoot apex meristem, vascular bundles in leaf sheath, and youngnodal roots supports its role in cell wall modification processes during active growth.
Alternative Organ- and Cell Type-Expression Profiles of OsXTH8
To examine the tissue specificity of OsXTH8, total RNAs from rice callus, root, leaf blade, and leaf sheath were hybridized with OsXTH8-specific DNA probe. A strong signal was detected in leaf sheaths but weak or no signal was observed in leaf blades, roots, and calli (Fig. 4A). These expressions were enhanced by GA3 treatment (Fig. 4A). When 1-month-old seedlings were used to characterize the expression in leaf sheath, the expression was mainly found in the three basal parts of leaf sheath (Fig. 4B). Enhanced expression of OsXTH8 in the third part of 1-month-old rice seedling, which corresponded to the second internode of leaf sheath, compared to two basal parts of leaf sheath showed that OsXTH8 is differentially expressed in leaf sheath.
Evolution
The analysis revealed that XTHs could be loosely grouped into four distinct groups (Fig. 3). Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues. Group 2 comprises XTH genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related XTHs. Group 3 represents a divergent group of XTHs, including NXG1 from nasturtium (Tropaeolum majus) that can act as xyloglucan hydrolase and transglycosylase. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (Hordeum vulgare) genes, HvPM2 and HvPM5,which are up-regulated by GA in barley leaf sheaths and leaves. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8.
Labs working on this gene
National Institute of Agrobiological Sciences, Tsukuba 305–8602, Japan (A.J., G.Y., H.N., H.I., S.K.);
University of Tsukuba, Tsukuba 305–8572, Japan (A.J., H.M.);
Nagoya University, Nagoya 464–8601, Japan (H.K., M.M.);
National Institute of Crop Science, Tsukuba 305-8518, Japan.
References
[1] Jan A, Yang G, Nakamura H, et al. Characterization of a xyloglucan endotransglucosylase gene that is up-regulated by gibberellin in rice [J]. Plant physiology, 2004, 136(3): 3670-3681.
[2]Tanaka T, Antonio B A, Kikuchi S, et al. The rice annotation project database (RAP-DB): 2008 update[J]. Nucleic acids research, 2008, 36(Sup 1): D1028-D1033.
[3]Rice Annotation Project, et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Genome Res, 2007, 17: 175-183.
[4] Ohyanagi H, et al. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Nucleic Acids Research, 2006, 34: D741-D744.
[5] International Rice Genome Sequencing Project. The map-based sequence of the rice genome. Nature, 2005,436(11): 793-800.
[6] Asad Jan and Setsuko Komatsu. Functional Characterization of Gibberellin-Regulated Genes in Rice Using Microarray System. Geno. Prot. Bioinfo. 2006,4(3): 137-144.
Structured Information
| Gene Name |
Os08g0237000 |
|---|---|
| Description |
Xyloglucan endotransglycosylase/hydrolase protein 8 precursor (EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5) |
| Version |
NM_001067854.1 GI:115475444 GeneID:4345019 |
| Length |
1378 bp |
| Definition |
Oryza sativa Japonica Group Os08g0237000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:8327025..8328402 |
| Sequence Coding Region |
8327064..8327545,8327644..8328034 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:8327025..8328402 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:8327025..8328402 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgaagcatctcgcgctgtccgtggccgccgcggtggccgtgtcgtggctggcggcgtcgtcggcggcggcggcggggttctacgagaagttcgacgtggtgggcgccggcgaccacgtgagggtggtgagcgacgacgggaagacgcagcaggtggcgctgacgctggaccggagctccgggtccgggttcacctccaaggacacctacctgttcggcgagttcagcgtccagatgaagctcgtcggcggcaactccgccggcaccgtcacctccttctacctctcctccggcgagggcgacggccacgacgagatcgacatcgagttcatgggcaacctcagcggcaacccctacgtcatgaacaccaacgtctgggctaatggcgacggcaagaaggagcaccagttctacctctggttcgaccccaccgccgacttccacacctacaagatcatctggaatccccaaaacatcatattccaggtggacgacgtgccggtgaggacgttcaagaagtacgacgacctggcgtacccgcagagcaagccgatgaggctgcacgcgacgctgtgggacggcagctactgggcgacgaggcacggcgacgtcaagatcgactggagcggcgcgccgttcgtggtgtcgtaccgcgggtacagcaccaacgcgtgcgtcaacaacaatcccgccggcgggtggtcgtcgtcgtggtgccccgagggcacgtcggcgtggatccaccgcgagctcgacggcgccgagctcggcaccgtcgcgtgggccgagcgcaactacatgtcctacaactactgcgccgacggctggcgcttcccccagggcttccccgccgagtgctaccgcaagtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAKHLALSVAAAVAVSWLAASSAAAAGFYEKFDVVGAGDHVRVV SDDGKTQQVALTLDRSSGSGFTSKDTYLFGEFSVQMKLVGGNSAGTVTSFYLSSGEGD GHDEIDIEFMGNLSGNPYVMNTNVWANGDGKKEHQFYLWFDPTADFHTYKIIWNPQNI IFQVDDVPVRTFKKYDDLAYPQSKPMRLHATLWDGSYWATRHGDVKIDWSGAPFVVSY RGYSTNACVNNNPAGGWSSSWCPEGTSAWIHRELDGAELGTVAWAERNYMSYNYCADG WRFPQGFPAECYRK</aaseq> |
| Gene Sequence |
<dnaseqindica>40..521#620..1010#atccaccacccaaagacaaagcaagcaagtacagtagccatggcgaagcatctcgcgctgtccgtggccgccgcggtggccgtgtcgtggctggcggcgtcgtcggcggcggcggcggggttctacgagaagttcgacgtggtgggcgccggcgaccacgtgagggtggtgagcgacgacgggaagacgcagcaggtggcgctgacgctggaccggagctccgggtccgggttcacctccaaggacacctacctgttcggcgagttcagcgtccagatgaagctcgtcggcggcaactccgccggcaccgtcacctccttctacctctcctccggcgagggcgacggccacgacgagatcgacatcgagttcatgggcaacctcagcggcaacccctacgtcatgaacaccaacgtctgggctaatggcgacggcaagaaggagcaccagttctacctctggttcgaccccaccgccgacttccacacctacaagatcatctggaatccccaaaacatcatgtacgcatcacaaaaacgaactcaataatcctctcttcgtcaatcaaacaatcatcgtgttaatttgctgaattacgattacttccgctatgatacagattccaggtggacgacgtgccggtgaggacgttcaagaagtacgacgacctggcgtacccgcagagcaagccgatgaggctgcacgcgacgctgtgggacggcagctactgggcgacgaggcacggcgacgtcaagatcgactggagcggcgcgccgttcgtggtgtcgtaccgcgggtacagcaccaacgcgtgcgtcaacaacaatcccgccggcgggtggtcgtcgtcgtggtgccccgagggcacgtcggcgtggatccaccgcgagctcgacggcgccgagctcggcaccgtcgcgtgggccgagcgcaactacatgtcctacaactactgcgccgacggctggcgcttcccccagggcttccccgccgagtgctaccgcaagtgattttgaactcgatcgattcaaatcctcctccattgatgagttcttggcaatgatttgtaattgcttcttgttcttgttttcgtcttcgtcttcgtcttcttcttcttgatccatgtacattttgccatccattcgttctccatttgttacagttacagagacaggttgatggtgaattactattgccgccaatttttttcttcttcttgttactcgatccaattattactactagagttcatcttgcacagttgggcggtgtgaaaaactgaaaaagaaaagggtgtcaaatttgttgctgatgctgagcaagtgagcacatgcttatgctctcaggtatgaacaaaataaacagtaaaattatctgc</dnaseqindica> |
| External Link(s) |

