Difference between revisions of "Os01g0972900"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
The data obtained from the fission yeast experiment prompted a further investigation into the functional role of OsCCS52B in plants. For this purpose, the T-DNA tagging mutant (line 1B-10423) was utilized. In this line, a T-DNA was inserted within the first exon of OsCCS52B at nucleotide number 120 (Fig. 5a). RT-PCR analysis using the gene-specific primers indicated that endogenous OsCCS52B transcripts were absent in homozygous mutants (Fig. 5d). A morphological comparison of the early development stage (seedling) showed that the mutant had smaller leaves and roots, as compared to the wild type (Fig. 5b). These phenotypes, consistent until the plant reached a mature stage, resulted in a semi-dwarf phenotype (Fig. 5c). The height of the mutant reached about ~83 % of the wild type. Further investigation revealed that the semi-dwarf phenotype of the mutant was due to a reduced internode length. Consistently, all internodes of the mutant plant were shorter than the wild type (Fig. 5e). Another distinguished feature of the mutant line 1B-10423 was the kernel size. The kernels were narrower than the corresponding wild-type kernels, as determined by reduced seed width and thickness (Fig. 6a, b). The correlation between kernel size and cell or nuclei size was then further investigated using microscopic analysis. At 15 days after pollination (DAP), the endosperm of the wild type and line 1B-10423 were sectioned longitudinally and stained with 4′,6-diamidino-2-phenylindole (DAPI) to visualize the nuclei. Histological analysis revealed that size of the nuclei in the mutant was similar to that in the wild-type. However, the size and number of cells in mutant endosperm were different from those in the wild-type. The cell size in the mutant was smaller than that in the corresponding wild-type; the mutant also contained more cells (Fig. 6c, d). In addition, the ploidy level in mutant endosperm was compared with that in the wild-type using flow cytometry. The results showed that the ploidy level in mutant endosperm was 2C, 3C, 6C, and 12C, i.e., identical to that in the corresponding wild-type (Fig. 6e).
  
 
===Expression===
 
===Expression===

Revision as of 06:19, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The data obtained from the fission yeast experiment prompted a further investigation into the functional role of OsCCS52B in plants. For this purpose, the T-DNA tagging mutant (line 1B-10423) was utilized. In this line, a T-DNA was inserted within the first exon of OsCCS52B at nucleotide number 120 (Fig. 5a). RT-PCR analysis using the gene-specific primers indicated that endogenous OsCCS52B transcripts were absent in homozygous mutants (Fig. 5d). A morphological comparison of the early development stage (seedling) showed that the mutant had smaller leaves and roots, as compared to the wild type (Fig. 5b). These phenotypes, consistent until the plant reached a mature stage, resulted in a semi-dwarf phenotype (Fig. 5c). The height of the mutant reached about ~83 % of the wild type. Further investigation revealed that the semi-dwarf phenotype of the mutant was due to a reduced internode length. Consistently, all internodes of the mutant plant were shorter than the wild type (Fig. 5e). Another distinguished feature of the mutant line 1B-10423 was the kernel size. The kernels were narrower than the corresponding wild-type kernels, as determined by reduced seed width and thickness (Fig. 6a, b). The correlation between kernel size and cell or nuclei size was then further investigated using microscopic analysis. At 15 days after pollination (DAP), the endosperm of the wild type and line 1B-10423 were sectioned longitudinally and stained with 4′,6-diamidino-2-phenylindole (DAPI) to visualize the nuclei. Histological analysis revealed that size of the nuclei in the mutant was similar to that in the wild-type. However, the size and number of cells in mutant endosperm were different from those in the wild-type. The cell size in the mutant was smaller than that in the corresponding wild-type; the mutant also contained more cells (Fig. 6c, d). In addition, the ploidy level in mutant endosperm was compared with that in the wild-type using flow cytometry. The results showed that the ploidy level in mutant endosperm was 2C, 3C, 6C, and 12C, i.e., identical to that in the corresponding wild-type (Fig. 6e).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0972900

Description

Similar to Clone ZZD405 mRNA sequence. (Fragment)

Version

NM_001052078.1 GI:115442526 GeneID:4326397

Length

3262 bp

Definition

Oryza sativa Japonica Group Os01g0972900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:44744264..44747525

Sequence Coding Region

44744407..44744889,44744998..44745225,44745689..44745868,44746003..44746257,44746339..44746443
,44746865..44746927,44747014..44747082,44747159..44747212

Expression

GEO Profiles:Os01g0972900

Genome Context

<gbrowseImage1> name=NC_008394:44744264..44747525 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:44744264..44747525 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgacggacgcgtcccccaagccggcgccgccgcgcctcaacgtgccgccggcgatggcgggggggctccgcctcgatcccgccgtcgcctccccggcccgcctcctcctcgacgtccccaagacgccatccccttccaagaccacgtacagcgaccgcttcatcccctgccgctcctcctcccgcctccacaacttcgccctcctcgaccgcgaccgcgcctccccctcctccaccaccgacgacgccccctactcccgcctcctccgcgccgagatcttcggcccggactccccctccccggctccctcctcccccaacaccaacctcttccgcttcaagaccgaccacccctcgcccaaatcgcccttcgccgcctccgccgccgccaccgccggccactacgactgcaccgccggctccgctgaatcctccacgccgcgcaagccgcccaggaaggtccccaagaccccgcacaaggtcctggacgcgccgtcgctgcaggacgacttctacctcaatcttgtcgactggtcgtcgcagaacacgctcgccgtcggcctcgggaattgcgtctacctctggtcggcttccaattgcaaggtcaccaagctctgcgatttggggcccagggacagcgtctgcgctgtgcactggacccgagaaggctcctatcttgccatcggcaccagccttggcgatgtccagatttgggatagctctcgctgtaaacggattaggaacatgggaggacaccaaacacggactggtgtattagcatggagctcccgaatcttgtcctccggtagcagggacaagaacatattgcagcatgacatccgtgtcccaagtgactatatcagcaagttctcagggcacagatcagaggtctgtggactgaaatggtcgcacgacgaccgtgagcttgcatccggtggaaatgataatcagctgctagtatggaaccaacgttcgcagcagccgatattgaggctgacagaacacacagctgcagttaaagcaatagcatggtcaccacatcagcaaggcctcctggcatcaggtggtggaaccgctgataggtgtatcaggttctggaacacggttaatggaaacatgctgaattcagtggacacaggcagccaggtttgtaatcttgcctggtgtaaaaatgtaaatgagcttgtgagcactcatgggtattcccaaaaccaaatcatggtgtggaagtacccatctatgtcaaaggttgctactctaactggacacacgctgcgagtgctttaccttgcaatgtcacctgatggacagacaatagtaacaggagccggggatgaaaccctcagattttggaatatttttccttcaatgaagacacaggctcctgttcgtgatattgggctctggtcattctcgagaagccacatacggtga</cdnaseq>

Protein Sequence

<aaseq>MATDASPKPAPPRLNVPPAMAGGLRLDPAVASPARLLLDVPKTP SPSKTTYSDRFIPCRSSSRLHNFALLDRDRASPSSTTDDAPYSRLLRAEIFGPDSPSP APSSPNTNLFRFKTDHPSPKSPFAASAAATAGHYDCTAGSAESSTPRKPPRKVPKTPH KVLDAPSLQDDFYLNLVDWSSQNTLAVGLGNCVYLWSASNCKVTKLCDLGPRDSVCAV HWTREGSYLAIGTSLGDVQIWDSSRCKRIRNMGGHQTRTGVLAWSSRILSSGSRDKNI LQHDIRVPSDYISKFSGHRSEVCGLKWSHDDRELASGGNDNQLLVWNQRSQQPILRLT EHTAAVKAIAWSPHQQGLLASGGGTADRCIRFWNTVNGNMLNSVDTGSQVCNLAWCKN VNELVSTHGYSQNQIMVWKYPSMSKVATLTGHTLRVLYLAMSPDGQTIVTGAGDETLR FWNIFPSMKTQAPVRDIGLWSFSRSHIR</aaseq>

Gene Sequence

<dnaseqindica>144..626#735..962#1426..1605#1740..1994#2076..2180#2602..2664#2751..2819#2896..2949#tgaccgttgcaacctcatctccgctcctcttcctcctcctcgtcgtcgttgtcgtcgtcggcggcgcatccagcctcgacgtgccggcggcggtgggtggcggggcagcagacgagcaagaaagagatccctagtctctctcgatggcgacggacgcgtcccccaagccggcgccgccgcgcctcaacgtgccgccggcgatggcgggggggctccgcctcgatcccgccgtcgcctccccggcccgcctcctcctcgacgtccccaagacgccatccccttccaagaccacgtacagcgaccgcttcatcccctgccgctcctcctcccgcctccacaacttcgccctcctcgaccgcgaccgcgcctccccctcctccaccaccgacgacgccccctactcccgcctcctccgcgccgagatcttcggcccggactccccctccccggctccctcctcccccaacaccaacctcttccgcttcaagaccgaccacccctcgcccaaatcgcccttcgccgcctccgccgccgccaccgccggccactacgactgcaccgccggctccgctgaatcctccacgccgcgcaagccgcccaggaaggtccccaagaccccgcacaaggtgggttcccaacgttccttcttccctcttcttgggcatttccacaaacacccactgcgcaactaaaacaatcttttggtttccgatccgtgtgcgtgcgcaactcaggtcctggacgcgccgtcgctgcaggacgacttctacctcaatcttgtcgactggtcgtcgcagaacacgctcgccgtcggcctcgggaattgcgtctacctctggtcggcttccaattgcaaggtcaccaagctctgcgatttggggcccagggacagcgtctgcgctgtgcactggacccgagaaggctcctatcttgccatcggcaccagccttggcgatgtccaggtttccccctctcatctcctctcctctactctctactgaataaattgcctgcagcatatgattgtcttcagtttatctatctagtacttagtagtaattgttttctacactctttagatttcatcacaacaattacacaaactatatacatcaattgttccaaatatcctgaatcctgggctgatgcaattcgcttcgttcaccatctcgtatgatagatgtacactagtaaagatttgaaacataagccctattgctgaaactctaaacttttattcgattctagtactaactatcactatcacaacacgtacatacttctttcaatgtgtccaggatgtgtgcgacagttttgtctgcaaatctcaaactacctatacttgaattagcctattgtttttgttcaactctgtgaatttgttcatggctatcgagaatttgatgcatacataaattccaacagatttgggatagctctcgctgtaaacggattaggaacatgggaggacaccaaacacggactggtgtattagcatggagctcccgaatcttgtcctccggtagcagggacaagaacatattgcagcatgacatccgtgtcccaagtgactatatcagcaagttctcagggcacagatcagaggtgagacttctaactacttccaagccataggtttttggaaaatagctcactaactatgcaagttaaaatcatcccatctcacagtaagatttcagaaccatgtatgtgcatcaagtgacagtttttttggtcaggtctgtggactgaaatggtcgcacgacgaccgtgagcttgcatccggtggaaatgataatcagctgctagtatggaaccaacgttcgcagcagccgatattgaggctgacagaacacacagctgcagttaaagcaatagcatggtcaccacatcagcaaggcctcctggcatcaggtggtggaaccgctgataggtgtatcaggttctggaacacggttaatggaaacatgctgaattcagtggacacaggcagccaggcgagtagttctgaacaagcctctaaaaagtagttcagtgaatttttactgtcatcctcaccagctgctttctgttttcaggtttgtaatcttgcctggtgtaaaaatgtaaatgagcttgtgagcactcatgggtattcccaaaaccaaatcatggtgtggaagtacccatctatgtcaaaggtaagcttaaattcccgtgggctgtcaagcctactaattcaccagttagacaattgtgcatcaagtaatcactcattcggataaaaacgtgaaaaaaagcagaggaagttatgtgtctgatttctcctagggttgtttccaaagaactcattcctttctgtgggccgagacattgactcatggattgcttaaacgcttaaaaggaatttagtatcaacatagttgacgagcatgtaatgcttaaaaagaacaatatcagtatggctgcaaatccaagtgaagtatttcacagggggctattttcatttgtatttgcagataaggataagagtagaataattcctttgaatttttaatatctgttcaagaaagatttccactagtgcagtaccactaagtattttatgttttcgataaacaggttgctactctaactggacacacgctgcgagtgctttaccttgcaatgtcacctgatggacaggtaaatctttttccaaactgcaaatcatgtatccggaaaaatattcctgggaatcgtcctaaatgatgcatattactcatttgcagacaatagtaacaggagccggggatgaaaccctcagattttggaatatttttccttcaatgaagacacaggtaggcatctattgttgaacacagattttatttattttgtggcttgtagcttgaactgccatattgtttgcaccaggctcctgttcgtgatattgggctctggtcattctcgagaagccacatacggtgaccataataggaggcaaagaaaatgcatatgtttgtatgaaacataattttctgaacttgtgcagttcttcagcgatttgtaaattgtgaggcctaattattcatttattgtttgtgtgcgcgtgtgtgtctgtgagatcgagagaaagggagaagaactcatattaacataaccaattctttgtattagaagctcataagtcggctagtttcttgtttggaatttcattgcagagaaacaagggccttgtaatttatcacaaacttatatgcttgtattattctcacacactttgtggccatttcatgacttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0972900, RefSeq:Os01g0972900