Difference between revisions of "Os08g0101000"

From RiceWiki
Jump to: navigation, search
(Function)
(Labs working on this gene)
Line 16: Line 16:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
 +
Quantitative RT-PCR for the early treatment of iron deficiency was found at each time point for analysis, IDEF1 expression of genes associated with the use of iron as OsIRO2, OsYSL15, OsIRT1, OsYSL2, OsNAS1, OsNAS2, OsNAS3, OsDMAS1 expression was positively correlated, however, in dealing with the this positive late correlation is not obvious. Microarray analysis and information indicating that these genes are upregulated by IDEF1, especially in the early treatment of iron deficiency, such as the promoter region of the gene sequence and the like contain CATGC IDE1 elements. These results suggest that plants respond to iron deficiency early and late stage presence stress response process, which IDEF1 involved in the early response process. By IDEF1 regulated gene promoter also contains regulate seed maturation cis-elements RY (CATGCA) required for gene expression. Some late embryogenesis abundant protein coding genes such as Osem, their expression in iron plant roots and / or leaves are induced, while expression is dependent on IDEF1, described IDEF1 in the regulation of seed maturation-related genes in vegetative organs of iron deficiency expression function (Kobayashi et al., 2007 & 2009).
  
 
==References==
 
==References==

Revision as of 09:04, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. Transcription factor IDEF1 early response to iron deficiency in rice necessary to express the late vegetative stage embryos while rich protein gene induction. Higher plants by regulating the expression of genes related to iron to maintain the plants get iron homeostasis of body iron content. IDEF1 to adjust the response of rice to iron deficiency by identifying the response CATGC sequence cis-elements IDE1. Medium to induce the expression of iron-deficiency treatment IDEF and suppress the expression of the two types of transgenic plants was found, and induce the expression of plant IDEF1 compared to suppress the expression of plant IDEF1 early iron deficiency is very sensitive.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Quantitative RT-PCR for the early treatment of iron deficiency was found at each time point for analysis, IDEF1 expression of genes associated with the use of iron as OsIRO2, OsYSL15, OsIRT1, OsYSL2, OsNAS1, OsNAS2, OsNAS3, OsDMAS1 expression was positively correlated, however, in dealing with the this positive late correlation is not obvious. Microarray analysis and information indicating that these genes are upregulated by IDEF1, especially in the early treatment of iron deficiency, such as the promoter region of the gene sequence and the like contain CATGC IDE1 elements. These results suggest that plants respond to iron deficiency early and late stage presence stress response process, which IDEF1 involved in the early response process. By IDEF1 regulated gene promoter also contains regulate seed maturation cis-elements RY (CATGCA) required for gene expression. Some late embryogenesis abundant protein coding genes such as Osem, their expression in iron plant roots and / or leaves are induced, while expression is dependent on IDEF1, described IDEF1 in the regulation of seed maturation-related genes in vegetative organs of iron deficiency expression function (Kobayashi et al., 2007 & 2009).

References

Please input cited references here.

Structured Information

Gene Name

Os08g0101000

Description

Transcriptional factor B3 family protein

Version

NM_001067292.1 GI:115474320 GeneID:4344415

Length

3946 bp

Definition

Oryza sativa Japonica Group Os08g0101000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:62575..66520

Sequence Coding Region

63028..63075,63607..63683,63765..63811,64155..64255,64363..64455
,64765..64887,64984..65102,65501..65857,66235..66358

Expression

GEO Profiles:Os08g0101000

Genome Context

<gbrowseImage1> name=NC_008401:62575..66520 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:62575..66520 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcaaatggacggcggcgacggcggcggcggcggccacccctaccactaccaggctctcctggccgccgtccaccagcagaccgtcccctttcccaatcccttccccgccccctcctccggagccgagcccccccacccgcacaaccacaaccacaaccacaatcacaaccacaatattcacaattctcacaatcacaaccacaatcacaatgctgctcctcacccttgtcacactcccactcccactcccactcccagaggtttcgccgactggagcgcctccaccagcgccttcacctcccttgccgcgcactcttctactgcccccagcaatgccgttcactacagcttctccccctgctatgccttctggacacattacatgctcaacaagaacgcctaccccacctccttccctgcgccacacgacgaccacctgcgccttgccaacaacaatcatcctagagacgcaccaggtcctgcatccagctacggggtcgagtcttttacttcaccgtccatggcaccgaatatttgcacccacatgcctcccatagaaggacccatatctgccaaggaagataagaaaccagagattttgcctagagtggttaagagcagtgatgaattggaaaccagaaacagcaatgttgaatttcactctgagacagttggtactctccctgagtcgaagcaaggccatgacagtcgtgctactaaactactcaactcgggagaataccaagtcattctgcgcaaggagctgacaaagagtgatgttggaaatgttggaagaattgtgctacccaagaaggatgcagaggctagtcttccacctttgttgcaaagggatcctttgatactgcacatggacgacatggtgctcccagtgacatggaagtttaagtacaggtactggccaaataacaaaagcagaatgtacattctggattctgcaggtgaatttctgaagacacatggtcttcaggctggggatgtcatcattatctacaaaaacttggctcctggcaaatttattatccgaggagagaaggccattcatcagcagacaacaaatccctag</cdnaseq>

Protein Sequence

<aaseq>MGQMDGGDGGGGGHPYHYQALLAAVHQQTVPFPNPFPAPSSGAE PPHPHNHNHNHNHNHNIHNSHNHNHNHNAAPHPCHTPTPTPTPRGFADWSASTSAFTS LAAHSSTAPSNAVHYSFSPCYAFWTHYMLNKNAYPTSFPAPHDDHLRLANNNHPRDAP GPASSYGVESFTSPSMAPNICTHMPPIEGPISAKEDKKPEILPRVVKSSDELETRNSN VEFHSETVGTLPESKQGHDSRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAE ASLPPLLQRDPLILHMDDMVLPVTWKFKYRYWPNNKSRMYILDSAGEFLKTHGLQAGD VIIIYKNLAPGKFIIRGEKAIHQQTTNP</aaseq>

Gene Sequence

<dnaseqindica>3446..3493#2838..2914#2710..2756#2266..2366#2066..2158#1634..1756#1419..1537#664..1020#163..286#ctcttcttcctcctcctggggcctagccgcctaggggggttgtggcctgcgactgcgacttcttcctctgccttctgctctctgcctctgagtatatggaatatggtgtgtgcgtgaagagaaattaagtgagggaggggaaagcgagcgaacagggcaacaatggggcaaatggacggcggcgacggcggcggcggcggccacccctaccactaccaggctctcctggccgccgtccaccagcagaccgtcccctttcccaatcccttccccgccccctcctccggtactctctctctctctctctacaccttcttctttcttacctcaaggaatgttagggcagcaggtaggcaggcagaccaccaaaattcagatctttttctttatctattactactatactatactattattaaaaaggaacaagagaatcttgaggtccttgtttaccatttattaatctagagatcccctcccctcccctcccctcccctccgcttctgcttgattgatttcattttgggtctactcctactatgtatgtattgtatttagggtgatcaatcattcctcactctgtctattcaattcattcacttcacttaattggcccatctatgtatgtatgtaaatgtaattgaccatgtgcttggattgcaggagccgagcccccccacccgcacaaccacaaccacaaccacaatcacaaccacaatattcacaattctcacaatcacaaccacaatcacaatgctgctcctcacccttgtcacactcccactcccactcccactcccagaggtttcgccgactggagcgcctccaccagcgccttcacctcccttgccgcgcactcttctactgcccccagcaatgccgttcactacagcttctccccctgctatgccttctggacacattacatgctcaacaagaacgcctaccccacctccttccctgcgccacacgacgaccacctgcgccttgccaacaacaatcatcctagagacgcaccaggtacgttaaaagctatctcctttccaactaaaccagcatgtactgcattgcctttttttccttttccttttaaagcaataaccaaaattaatcttccgttgcgttgttcagagctacagatgttgcttgtaacaactaggaatttttaccgacctagctcattttaattattcatgtgcctctgatgttgaacaagtaggtccatgaggcatttacattattcctctccatgcttccatcaatatgggtagtacatctaagctactgtattccactttggcattagctaatagccaggttttctcagtcatgtacatatggggcagctatttgcgtcccgccaaattctttcacccagccatcctcacttttttccacatatcctgttttaattacaggtcctgcatccagctacggggtcgagtcttttacttcaccgtccatggcaccgaatatttgcacccacatgcctcccatagaaggacccatatctgccaaggaagataagaaaccagaggtatatacatcagaacattcaagatttggaaaacccttccagttttcatcatcctccataacacataatctaactaccgtaatggatgctaaccagattttgcctagagtggttaagagcagtgatgaattggaaaccagaaacagcaatgttgaatttcactctgagacagttggtactctccctgagtcgaagcaaggccatgacagtcgtgctactgtgagtaacacactacacttaacatgctgtctgtatctgatttactacacaaatttctatcttgcatttaatctacattaggcaagtacatagcataagtaatggagcaagtatctatcaattactcaatgccgatatagtcatttgagcagaagggcaaatgaagcagcaattccttactagtttagtaattcaagtagcttgtaaagatgattagccaaaacactgatgcagtacacaggcacatacttctgtcataattagcaacttcatttcctttgtgttcatgggagtgtgcttttatgccagaaactactcaactcgggagaataccaagtcattctgcgcaaggagctgacaaagagtgatgttggaaatgttggaagaattgtgctacccaaggtgtgttccgtatttctgtctcttggaagttctctagtatcattctgtgagaactttcatgtggtctaaactatgcttcataatgtaactgtctgactttatttcagaaggatgcagaggctagtcttccacctttgttgcaaagggatcctttgatactgcacatggacgacatggtgctcccagtgacatggaagtttaagtacaggtgcctttcctgccatcttatgacatctctcacatgcgatttctgaaagacaacaaagaaaaaatggttctgaattgcaatgacttaacaagatgcctagattaagaaaaagtgggaggttgaaggcactgtatgcattaagttccacagcatgtttaggaatctgaaatttgtaaagcagttcataggttcatacatcttgtggcagctgcctgattgctaattctggttcggttacatgatcagttttcacaggatggagaaaccgatacattgctgcctaacctagatatactctagcacttgctactactaattcacagagtcaacgatgctatttcaggtactggccaaataacaaaagcagaatgtacattctggattctgcaggtatgattcaacatggaaagtattgagtatttcctgcggaagtggacatggtagattgatatttcgtattcatattggcaggtgaatttctgaagacacatggtcttcaggctggggatgtcatcattatctacaaaaacttggctcctggcaaatttgtatgcaacccttttctttcctgtttcttcctttttgtatattgcatatctgacgtcagcatttatggcttgcaaatctcaatcatcgcttgacataactgataaaaatgctcagtacaaaaagttgagaaaccttactaaatactacatccgttttttaatatatgacgcaattgactttttgacaaacgtttgatcatttgtcttattcaaattttttgtgcaaatatatatatatatattaagtgatgcttaaagaacatttcacaataaattaagtcacaataaaatatatgataattacatatttttttggaataaaatgaatagtcaaacatatctcaaaaagtcaacggtgtcatatattaaaaaacagagggagtaaaccaaaatgacaaacatatagatcaccactcatgaatattctgtgggatgcactcaaagttgccatctccgttcattttccctgaaaagtatgttaataacgattcttcgcatatcttattggacccttgtgttttttttacaaagattatccgaggagagaaggccattcatcagcagacaacaaatccctagatgcatttggggttaattgcaacagtgttagttgatgcatttgaagggaaggacgtggacttaccataagttggcaatccaggagaagttgaaagtgtcatcgatttttatatcactggtggccaccatcacatggacaaagattaaagcgcatgcagcttggacctgtttaactctgaatgaatgaggacgaaaaaaagacaagattggtagagtattggaagtgttggcaatgggcttctacagcttatcttgggttgagaaaagcacttgtcagtttatttaattcagttatgttggggagcttgacttgtagttttcagaacaatatatttgcagcttctgtaaatatttttggatctataagataaaagagagtggtgtgtgattttgcttttgatgtcatccatctatttctcatactaatgccaggaatgtctgttcattgtcagc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0101000, RefSeq:Os08g0101000