Difference between revisions of "Os08g0140300"
| Line 11: | Line 11: | ||
1.over-expression of TDC results in stunted growth, low fertility and the accumulation of serotonin, which when converted to serotonin dimer, leads to a dark brown plant color.The degree of stunted growth and dark-brown color was proportional to the expression levels of TDC-1. The levels of tryptamine and serotonin accu-mulation in these transgenic rice lines were also directly | 1.over-expression of TDC results in stunted growth, low fertility and the accumulation of serotonin, which when converted to serotonin dimer, leads to a dark brown plant color.The degree of stunted growth and dark-brown color was proportional to the expression levels of TDC-1. The levels of tryptamine and serotonin accu-mulation in these transgenic rice lines were also directly | ||
correlated with the expression levels of TDC-1. | correlated with the expression levels of TDC-1. | ||
| + | |||
[[File:ricewike2.jpg]] | [[File:ricewike2.jpg]] | ||
| Line 18: | Line 19: | ||
2.TDC plays a rate-limiting role for serotonin accumulation,and serotonin was abundant in the vascular parenchyma cells, including companion cells and xylem-parenchyma cells, suggestive of its involvement in maintaining the cellular integrity of these cells for facilitating efficient nutrient recycling from senescing leaves to sink tissues during senescence. | 2.TDC plays a rate-limiting role for serotonin accumulation,and serotonin was abundant in the vascular parenchyma cells, including companion cells and xylem-parenchyma cells, suggestive of its involvement in maintaining the cellular integrity of these cells for facilitating efficient nutrient recycling from senescing leaves to sink tissues during senescence. | ||
| + | |||
[[File:E3333e.jpg]] | [[File:E3333e.jpg]] | ||
[[File:44444le.jpg]] | [[File:44444le.jpg]] | ||
| Line 25: | Line 27: | ||
[[File:3e.jpg]] | [[File:3e.jpg]] | ||
2.Over-expression of TDC-1 and TDC-3 in transgenic rice recapitulated the stunted growth, dark-brown phenotype and resulted in a low fertility similar to M47286. | 2.Over-expression of TDC-1 and TDC-3 in transgenic rice recapitulated the stunted growth, dark-brown phenotype and resulted in a low fertility similar to M47286. | ||
| + | |||
[[File:4ple.jpg]] | [[File:4ple.jpg]] | ||
| Line 32: | Line 35: | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | 1,Department of Biotechnology, Interdisciplinary Program for Bioenergy and Biomaterials of Graduate School, Agricultural Plant Stress Research Center, Chonnam National University, Gwangju 500-757, South Korea. | |
| − | + | 2.Department of Molecular Biotechnology, Agricultural Plant Stress Research Center, Biotechnology Research Institute, Chonnam National University, Gwangju, South Korea. | |
| + | 3.Institute of Molecular Biology, National Chung Hsing University, Taichung 402, Taiwan. | ||
==References== | ==References== | ||
1. Parawee Kanjanaphachoat;Bi-Yin Wei;Shuen-Fang Lo;I-Wen Wang;Chang-Sheng Wang;Su-May Yu;Ming-Liang Yen;Sheng-Hsien Chiu;Chien-Chen Lai;Liang-Jwu Chen | 1. Parawee Kanjanaphachoat;Bi-Yin Wei;Shuen-Fang Lo;I-Wen Wang;Chang-Sheng Wang;Su-May Yu;Ming-Liang Yen;Sheng-Hsien Chiu;Chien-Chen Lai;Liang-Jwu Chen | ||
Revision as of 09:05, 9 June 2014
L-Tryptophan decarboxylase (TDC) belong to a family of aromatic L-amino acid decarboxylases and convert tryptophan to tryptamine, which could be converted to serotonin by a constitutively expressed tryptamine 5' hydroxylase (T5H). in rice plants.
Contents
Annotated Information
Function
tryptophan decarboxlyase activities that converted tryptophan to tryptamine, which could be converted to serotonin by a constitutively expressed tryptamine 5'hydroxylase (T5H) in rice plants.transgenic plants that produced TDC showed a normal phenotype and contained 25-fold and 11-fold higher serotonin in the leaves and seeds, respectively, than the wild-type plants.
1.over-expression of TDC results in stunted growth, low fertility and the accumulation of serotonin, which when converted to serotonin dimer, leads to a dark brown plant color.The degree of stunted growth and dark-brown color was proportional to the expression levels of TDC-1. The levels of tryptamine and serotonin accu-mulation in these transgenic rice lines were also directly correlated with the expression levels of TDC-1.
2.TDC plays a rate-limiting role for serotonin accumulation,and serotonin was abundant in the vascular parenchyma cells, including companion cells and xylem-parenchyma cells, suggestive of its involvement in maintaining the cellular integrity of these cells for facilitating efficient nutrient recycling from senescing leaves to sink tissues during senescence.
Expression
1.A mutant M47286 with a stunted growth, low fertility and dark-brown phenotype was identified from a T-DNA-tagged rice mutant library. This mutant contained a copy of the T-DNA tag inserted at the location where the expression of two putative tryptophan decarboxlyase genes, TDC -1 and TDC - 3 , were activated.
2.Over-expression of TDC-1 and TDC-3 in transgenic rice recapitulated the stunted growth, dark-brown phenotype and resulted in a low fertility similar to M47286.
Evolution
Labs working on this gene
1,Department of Biotechnology, Interdisciplinary Program for Bioenergy and Biomaterials of Graduate School, Agricultural Plant Stress Research Center, Chonnam National University, Gwangju 500-757, South Korea. 2.Department of Molecular Biotechnology, Agricultural Plant Stress Research Center, Biotechnology Research Institute, Chonnam National University, Gwangju, South Korea. 3.Institute of Molecular Biology, National Chung Hsing University, Taichung 402, Taiwan.
References
1. Parawee Kanjanaphachoat;Bi-Yin Wei;Shuen-Fang Lo;I-Wen Wang;Chang-Sheng Wang;Su-May Yu;Ming-Liang Yen;Sheng-Hsien Chiu;Chien-Chen Lai;Liang-Jwu Chen
Serotonin accumulation in transgenic rice by over-expressing tryptophan decarboxlyase results in a dark brown phenotype and stunted growth Plant Molecular Biology, 2012, 78(6): 525-543
2. Kiyoon Kang;Young-Soon Kim;Sangkyu Park;Kyoungwhan Back
Senescence-Induced Serotonin Biosynthesis and Its Role in Delaying Senescence in Rice Leaves Plant Physiology, 2009, 150(3): 1380-1393
3. Sei Kang;Kiyoon Kang;Kyungjin Lee;Kyoungwhan Back
Characterization of rice tryptophan decarboxylases and their direct involvement in serotonin biosynthesis in transgenic rice Planta, 2007, 227(1): 263-272
Structured Information
| Gene Name |
Os08g0140300 |
|---|---|
| Description |
Similar to Tryptophan decarboxylase |
| Version |
NM_001067503.1 GI:115474742 GeneID:4344636 |
| Length |
1866 bp |
| Definition |
Oryza sativa Japonica Group Os08g0140300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:2255010..2256875 |
| Sequence Coding Region |
2255141..2256685 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:2255010..2256875 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:2255010..2256875 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgggcagcttggacaccaaccccacggccttctccgccttccccgccggcgagggtgaaaccttccagccgctcaacgccgatgatgtccggtcctacctccacaaggcggtggacttcatctcggactactacaagtccgtggagtccatgccggtgctgcccaatgtcaagccggggtacctgcaggacgagctcagggcctcgccgccgacgtactcggcgccgttcgacgtcaccatgaaggagctccggagctccgtcgtccccgggatgacgcactgggcgagccccaacttcttcgcgtttttcccctccacgaatagtgcggccgccattgccggcgacctcatcgcgtcggcgatgaacacggtcgggttcacgtggcaggcgtcgccggcggccaccgagatggaggtgctcgcgctggactggctcgcgcagatgctcaacctgccgacgagcttcatgaaccgcaccggcgaggggcgtggcaccggcggtggggttattctggggacgaccagcgaggcgatgctcgtcacgctcgttgccgcgcgcgacgccgcgctgcggcggagcggcagcgacggcgtggcgggactccaccggctcgccgtgtacgccgccgaccagacgcactccacgttcttcaaggcgtgccgcctcgccgggtttgatccggcgaacatccggtcgatccccaccggggccgagaccgactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgccgggctggtgcccacctacgtgtgcgccacggtgggcaccacgtcgtccaacgccgtcgacccggtgggcgccgtggccgacgtcgcggcgaggttcgccgcgtgggtgcacgtcgacgcggcgtacgccggcagcgcgtgcatctgcccggagttcaggcaccacctcgacggcgtggagcgcgtggactccatcagcatgagcccccacaaatggctgatgacctgcctcgactgcacctgcctctacgtgcgcgacacccaccgcctcaccggctccctcgagaccaacccggagtacctcaagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggcgtcggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgtcgccaagctgcaggagcacatccggagcgacgtcgccatggccaaggtgttcgaggacctcgtccgcggcgacgacaggttcgaggtcgtcgtgccgaggaacttcgctctcgtctgcttcaggatcagggccggcgccggcgccgccgccgcgacggaggaggacgccgacgaggcgaaccgcgagctgatggagcggctgaacaagaccggcaaggcgtacgtggcgcacacggtggtcggcggcaggttcgtgctgcgcttcgcggtgggctcgtcgctgcaggaagagcatcacgtgcggagcgcgtgggagctcatcaagaagacgaccaccgagatgatgaactaa</cdnaseq> |
| Protein Sequence |
<aaseq>MGSLDTNPTAFSAFPAGEGETFQPLNADDVRSYLHKAVDFISDY YKSVESMPVLPNVKPGYLQDELRASPPTYSAPFDVTMKELRSSVVPGMTHWASPNFFA FFPSTNSAAAIAGDLIASAMNTVGFTWQASPAATEMEVLALDWLAQMLNLPTSFMNRT GEGRGTGGGVILGTTSEAMLVTLVAARDAALRRSGSDGVAGLHRLAVYAADQTHSTFF KACRLAGFDPANIRSIPTGAETDYGLDPARLLEAMQADADAGLVPTYVCATVGTTSSN AVDPVGAVADVAARFAAWVHVDAAYAGSACICPEFRHHLDGVERVDSISMSPHKWLMT CLDCTCLYVRDTHRLTGSLETNPEYLKNHASDSGEVTDLKDMQVGVGRRFRGLKLWMV MRTYGVAKLQEHIRSDVAMAKVFEDLVRGDDRFEVVVPRNFALVCFRIRAGAGAAAAT EEDADEANRELMERLNKTGKAYVAHTVVGGRFVLRFAVGSSLQEEHHVRSAWELIKKT TTEMMN</aaseq> |
| Gene Sequence |
<dnaseqindica>132..1676#aaaccaacacaccaacctagctaactcactcactcactccttcttcttgcgacctagctatcgagctagagcttccaaaaccctagctagctagctgagacagttagtttcatctcgaactagttgttgatatgggcagcttggacaccaaccccacggccttctccgccttccccgccggcgagggtgaaaccttccagccgctcaacgccgatgatgtccggtcctacctccacaaggcggtggacttcatctcggactactacaagtccgtggagtccatgccggtgctgcccaatgtcaagccggggtacctgcaggacgagctcagggcctcgccgccgacgtactcggcgccgttcgacgtcaccatgaaggagctccggagctccgtcgtccccgggatgacgcactgggcgagccccaacttcttcgcgtttttcccctccacgaatagtgcggccgccattgccggcgacctcatcgcgtcggcgatgaacacggtcgggttcacgtggcaggcgtcgccggcggccaccgagatggaggtgctcgcgctggactggctcgcgcagatgctcaacctgccgacgagcttcatgaaccgcaccggcgaggggcgtggcaccggcggtggggttattctggggacgaccagcgaggcgatgctcgtcacgctcgttgccgcgcgcgacgccgcgctgcggcggagcggcagcgacggcgtggcgggactccaccggctcgccgtgtacgccgccgaccagacgcactccacgttcttcaaggcgtgccgcctcgccgggtttgatccggcgaacatccggtcgatccccaccggggccgagaccgactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgccgggctggtgcccacctacgtgtgcgccacggtgggcaccacgtcgtccaacgccgtcgacccggtgggcgccgtggccgacgtcgcggcgaggttcgccgcgtgggtgcacgtcgacgcggcgtacgccggcagcgcgtgcatctgcccggagttcaggcaccacctcgacggcgtggagcgcgtggactccatcagcatgagcccccacaaatggctgatgacctgcctcgactgcacctgcctctacgtgcgcgacacccaccgcctcaccggctccctcgagaccaacccggagtacctcaagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggcgtcggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgtcgccaagctgcaggagcacatccggagcgacgtcgccatggccaaggtgttcgaggacctcgtccgcggcgacgacaggttcgaggtcgtcgtgccgaggaacttcgctctcgtctgcttcaggatcagggccggcgccggcgccgccgccgcgacggaggaggacgccgacgaggcgaaccgcgagctgatggagcggctgaacaagaccggcaaggcgtacgtggcgcacacggtggtcggcggcaggttcgtgctgcgcttcgcggtgggctcgtcgctgcaggaagagcatcacgtgcggagcgcgtgggagctcatcaagaagacgaccaccgagatgatgaactaagtaaagagaagattacaaataaatacacatatttagaacacatatacgtttttgatttttttttttggggttttagatgcgaatctgttgattcattttgtgagctatttatacctatggatatatggatcaaaataaattattatttggttgtaatttttttaaaagatgaactgatactataccttac</dnaseqindica> |
| External Link(s) |




