Difference between revisions of "Os01g0929600"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles. RTS is a unique gene in the rice genome. a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.
 
A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles. RTS is a unique gene in the rice genome. a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.
 
[[File:Fig. 4 Morphology of anthers and viability test.jpg|frame|Morphology of anthers and viability test of pollen from transgenic rice plants (T0) transformed with the antisense RTS gene construct. (A) and (B) Anthers from transgenic rice plants that contain antisense RTS gene (right) shriveled compared to that from a transgenic control rice plant that did not contain the antisense RTS gene (left). (C) IKI2 staining of pollen from the
 
transgenic control rice plant that did not contain the antisense RTS gene. (D) IKI2 staining of pollen from male-sterile transgenic plants expressing the antisense RTS gene. Scale bar is 400 um.]]
 
  
 
===Expression===
 
===Expression===

Revision as of 09:40, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles. RTS is a unique gene in the rice genome. a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0929600

Description

Conserved hypothetical protein

Version

NM_001051819.1 GI:115442008 GeneID:4326940

Length

585 bp

Definition

Oryza sativa Japonica Group Os01g0929600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:42592788..42593372

Sequence Coding Region

42593018..42593293

Expression

GEO Profiles:Os01g0929600

Genome Context

<gbrowseImage1> name=NC_008394:42592788..42593372 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:42592788..42593372 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctga</cdnaseq>

Protein Sequence

<aaseq>MVRVGAAAAVLVLAAAAAAMAAEPPTDDGAVRVAAGLTKCVSGC GSKVTSCLLGCYGGGGGAAAAATAMPFCVIGCTSDVLSCATGCSTSL</aaseq>

Gene Sequence

<dnaseqindica>80..355#tgcatcatcatcatcagctcgatagaaaaagaaagaaattaaaaagaaaatcacggcgcgtgagcttgcagagacagcaatggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctgattaagtactaatgaagtaattaaccgcgctaattaataataaatcgcacctacgtatgccacatgtggactcgcttgactaattaaatactgccatgcgaatgcgattagtggattatgaaaagaggaaatgtaagaactcatggctctctctgtgccatgcctgtactgcattgaaatgaatctgcatgcagccatgaactgatatacaaatacgaccatgttacctgt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0929600, RefSeq:Os01g0929600