Difference between revisions of "Os01g0929600"
(→Function) |
(→Expression) |
||
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | + | RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region. | |
| + | |||
| + | [[File:rst.jpg|frame|Fig. 1 Northern blot analysis of the RTS gene.]] | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 09:43, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles. RTS is a unique gene in the rice genome. a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.
Expression
RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0929600 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001051819.1 GI:115442008 GeneID:4326940 |
| Length |
585 bp |
| Definition |
Oryza sativa Japonica Group Os01g0929600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:42592788..42593372 |
| Sequence Coding Region |
42593018..42593293 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:42592788..42593372 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:42592788..42593372 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctga</cdnaseq> |
| Protein Sequence |
<aaseq>MVRVGAAAAVLVLAAAAAAMAAEPPTDDGAVRVAAGLTKCVSGC GSKVTSCLLGCYGGGGGAAAAATAMPFCVIGCTSDVLSCATGCSTSL</aaseq> |
| Gene Sequence |
<dnaseqindica>80..355#tgcatcatcatcatcagctcgatagaaaaagaaagaaattaaaaagaaaatcacggcgcgtgagcttgcagagacagcaatggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctgattaagtactaatgaagtaattaaccgcgctaattaataataaatcgcacctacgtatgccacatgtggactcgcttgactaattaaatactgccatgcgaatgcgattagtggattatgaaaagaggaaatgtaagaactcatggctctctctgtgccatgcctgtactgcattgaaatgaatctgcatgcagccatgaactgatatacaaatacgaccatgttacctgt</dnaseqindica> |
| External Link(s) |
