Difference between revisions of "Os01g0929600"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 8: Line 8:
 
RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region.  
 
RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region.  
  
[[File:rst.jpg|right|Fig. 1 Northern blot analysis of the RTS gene.]]
+
[[File:rst.jpg|right|150px|Fig. 1 Northern blot analysis of the RTS gene.]]
  
 
===Evolution===
 
===Evolution===

Revision as of 09:57, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles. RTS is a unique gene in the rice genome. a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.

Expression

RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region.

Fig. 1 Northern blot analysis of the RTS gene.

Evolution

The nucleotide and deduced amino acid sequence of the gene do not show significant homology to any known sequences. However, a sequence in the promoter region, GAATTTGTTA, differs only by one or two nucleotides from one of the conserved motifs in the promoter region of two pollen-specific genes of tomato. Several other sequence motifs found in other anther-specific promoters were also identified in the promoter of the RTS gene.The promoter region of RTS, when fused to the Bacillus amyloliquefaciens ribonuclease gene, barnase, or the antisense of the RTS gene, is able to drive tissue-specific expression of both genes in rice, creeping bentgrass (Agrostis stolonifera L.) and Arabidopsis, conferring male sterility to the transgenic plants. Light and near-infrared confocal microscopy of cross-sections through developing flowers of male-sterile transgenics shows that tissue-specific expression of barnase or the antisense RTS genes interrupts tapetal development, resulting in deformed non-viable pollen. Fig. 2 Induction of male sterility in rice and creeping bentgrass through tissue-specific expression of barnase driven by the promoter of the rice tapetum-specific RTS gene. Anthers from transgenic control rice (A) and creeping bentgrass (C) plants that do not contain TAP-driving barnase and from male-sterile transgenic rice (B) and creeping bentgrass (D) plants expressing barnase gene. Note that there is no pollen produced in the male-sterile transgenics. (E) Light microscopy of cross-sectioned anthers from transgenic control creeping bentgrass plants that do not contain TAP driving barnase. (F) Light microscopy of cross-sectioned anther from male-sterile transgenic creeping bentgrass plant expressing TAP driving barnase gene. Note the abnormal anther and pollen development. Scale bar is 100 um.

Labs working on this gene

This work was supported by grants from the Rockefeller foundation to Purdue University (T.K.H.) and in part by the USDA-SBIR Grants #2003-33610-13107, #2005-33610-15620 to HybriGene Inc. (H.L.) and by the USDA-BRAG grant #2005-39454-16511 to Clemson University (H.L.). Technical Contribution No. 5214 of the Clemson University Experiment Station.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0929600

Description

Conserved hypothetical protein

Version

NM_001051819.1 GI:115442008 GeneID:4326940

Length

585 bp

Definition

Oryza sativa Japonica Group Os01g0929600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:42592788..42593372

Sequence Coding Region

42593018..42593293

Expression

GEO Profiles:Os01g0929600

Genome Context

<gbrowseImage1> name=NC_008394:42592788..42593372 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:42592788..42593372 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctga</cdnaseq>

Protein Sequence

<aaseq>MVRVGAAAAVLVLAAAAAAMAAEPPTDDGAVRVAAGLTKCVSGC GSKVTSCLLGCYGGGGGAAAAATAMPFCVIGCTSDVLSCATGCSTSL</aaseq>

Gene Sequence

<dnaseqindica>80..355#tgcatcatcatcatcagctcgatagaaaaagaaagaaattaaaaagaaaatcacggcgcgtgagcttgcagagacagcaatggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctgattaagtactaatgaagtaattaaccgcgctaattaataataaatcgcacctacgtatgccacatgtggactcgcttgactaattaaatactgccatgcgaatgcgattagtggattatgaaaagaggaaatgtaagaactcatggctctctctgtgccatgcctgtactgcattgaaatgaatctgcatgcagccatgaactgatatacaaatacgaccatgttacctgt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0929600, RefSeq:Os01g0929600