Difference between revisions of "Os02g0802700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 8: Line 8:
  
 
===Expression===
 
===Expression===
OsMGD encodes monogalactosyldiacylglycerol synthase (UDPgalactose: 1,2-diacylglycerol 3-β-D-galactosyl transferase; EC 2.4.1.46, MGDG synthase)
+
  OsMGD encodes monogalactosyldiacylglycerol synthase (UDPgalactose: 1,2-diacylglycerol 3-β-D-galactosyl transferase; EC 2.4.1.46, MGDG synthase)
 +
  Time-course studies showed that the expression of OsMGD in the rice cultivars FR13A and IR42 (submergence-susceptive cultivar) during submergence was gradually increased and that expression in FR13A was higher than in IR42. The expression of OsMGD in FR13A was influenced by benzyladenine and illumination. The accumulation of OsMGD mRNA in both FR13A and IR42 was also increased by ethephon, gibberellin, drought and salt treatment, but cold stress had no effect on the expression of the gene. These results suggest that the expression of OsMGD mRNA requires benzyladenine or illumination, and that the process is also mediated by ethephon and gibberellin. Salt and drought stress have an effect similar to that of submergence. Furthermore, the enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence.
  
 
===Evolution===
 
===Evolution===

Revision as of 10:42, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsMGD play an important role in coping various stresses for plants, which also provide us a possible approach to enhance plant multiple stresses tolerance.The enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence.

The full length of OsMGD cDNA was amplified using 5'- and 3'-rapid amplification of cDNA ends, and found to consist of 1,671 bp with an open reading frame of 1,077 bp (181-1257) encoding 358 amino acids.

Expression

  OsMGD encodes monogalactosyldiacylglycerol synthase (UDPgalactose: 1,2-diacylglycerol 3-β-D-galactosyl transferase; EC 2.4.1.46, MGDG synthase)
  Time-course studies showed that the expression of OsMGD in the rice cultivars FR13A and IR42 (submergence-susceptive cultivar) during submergence was gradually increased and that expression in FR13A was higher than in IR42. The expression of OsMGD in FR13A was influenced by benzyladenine and illumination. The accumulation of OsMGD mRNA in both FR13A and IR42 was also increased by ethephon, gibberellin, drought and salt treatment, but cold stress had no effect on the expression of the gene. These results suggest that the expression of OsMGD mRNA requires benzyladenine or illumination, and that the process is also mediated by ethephon and gibberellin. Salt and drought stress have an effect similar to that of submergence. Furthermore, the enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0802700

Description

Similar to MGDG synthase type A

Version

NM_001054958.1 GI:115449286 GeneID:4331045

Length

4212 bp

Definition

Oryza sativa Japonica Group Os02g0802700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:35110098..35114309

Sequence Coding Region

35110099..35110336,35110863..35110890,35111867..35112028,35112130..35112271,35112688..35112912
,35113017..35113079,35113185..35113259,35113566..35113853

Expression

GEO Profiles:Os02g0802700

Genome Context

<gbrowseImage1> name=NC_008395:35110098..35114309 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:35110098..35114309 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ctcgcctccccaattttaaactcccttctctctctctctcgtcgtcgtcgtccaccgccgcaaaggggtctcgtctctctcgggggcgatggcggcgtcgtcgtcgtcgtcgtcgtcgatggcgtcgccgagggggaggtcgatccgggagacggtgctggagacggtggcggcgtaccaccagcagcagaggatgaggcgcaagttcaggaagagcctctcctacgcgggggagctgtcgccgcgctcgcctcattctatgccaagaaggttgaggctggactcaagaagtacaaaccagatattataattagtgtccaccccctcatgcaacacattcctctatgggtactcaaatggcaagggctacaaaatagagtggtctttgtcactgtcatcacagacctcaacacttgtcaccctacatggttccatgctgatgtcaatagatgttactgcccatcggaagaagttgccaagagagcagcactggatgacctacaaccttctcaaatccgtgtgtttggccttccgattcggccatcattctgccgagccgttcttgttaaggatgatttgaggaaggaacttgaattggatcctgagctgcctgcagtattgctgatgggaggtggagagggcatgggtcctgtcaagaagaccgcaaaagcccttggagagtcgttgtttgacaaggagcttggaaaaccaattggacagttaattgtcatttgtggtcggaacaaaacgctgagctcctcattgcaggctcttgaatggaaaataccaattaaggttaggggatttgagacccagatggagaaatggatgggggcttgtgattgcattataacaaaggctggaccaggtaccatcgccgaagccttgattagagggttgcctatcatccttaatgacttcatacctggacaggaagttggcaatgtcccttatgttgtggacaatggtgctggtgtcttctccaaaagttctagggaaactgctaaacttgttgcccgctggtttggtccagattctgatgaactgaagaggatgtcagaaaaagcgttaaaactggctcagccagaagcggtgtttgatattgtcagagacatccatgagctatctcgggagcaaggggtgatttcacagatatccagttccttgacatcatcctttttcataccatcgccagaaaccacacctatacaacttatgtga</cdnaseq>

Protein Sequence

<aaseq>LASPILNSLLSLSRRRRPPPQRGLVSLGGDGGVVVVVVVDGVAE GEVDPGDGAGDGGGVPPAAEDEAQVQEEPLLRGGAVAALASFYAKKVEAGLKKYKPDI IISVHPLMQHIPLWVLKWQGLQNRVVFVTVITDLNTCHPTWFHADVNRCYCPSEEVAK RAALDDLQPSQIRVFGLPIRPSFCRAVLVKDDLRKELELDPELPAVLLMGGGEGMGPV KKTAKALGESLFDKELGKPIGQLIVICGRNKTLSSSLQALEWKIPIKVRGFETQMEKW MGACDCIITKAGPGTIAEALIRGLPIILNDFIPGQEVGNVPYVVDNGAGVFSKSSRET AKLVARWFGPDSDELKRMSEKALKLAQPEAVFDIVRDIHELSREQGVISQISSSLTSS FFIPSPETTPIQLM</aaseq>

Gene Sequence

<dnaseqindica>2..239#766..793#1770..1931#2033..2174#2591..2815#2920..2982#3088..3162#3469..3756#actcgcctccccaattttaaactcccttctctctctctctcgtcgtcgtcgtccaccgccgcaaaggggtctcgtctctctcgggggcgatggcggcgtcgtcgtcgtcgtcgtcgtcgatggcgtcgccgagggggaggtcgatccgggagacggtgctggagacggtggcggcgtaccaccagcagcagaggatgaggcgcaagttcaggaagagcctctcctacgcgggggagctgtcgtcggcggggcgcgcgcgaggggagggcggggcgtcctcgtcggcgtccaccacctcgctgtgtggccccgacgaggacgacgagcccttctgggaggaggaggagggcaccgtcgagctcgtccagctcggcgccaaccgggctaagaacgtgctcatcctcatgagcgacaccggcggcggccaccgcgcctccgccgaggctatcaaggacgccttccgcatcgagttcggcgacgattaccgggtgcgcggcctcctttttttttttttgctgctgtcgtctcgtgtgaaatcggcatggtagcgtaggctggaatctggccattgggaacacaagggttttgatttgttgtgctcgggattggcgttgtggcaggtcttcgtcaaggatctgtgcaaggatcacgcggggtggccgctgaacaacatggagagctcgtacaagttcatggtgaagcatgtgcagctatggaaggtggccttccacaccacatcgccgagatgggtccattgcttctacctcgccgcgctcgcctcattctatgccaagtacgccggatacttccctttcacggctcagcaatgtttttttaaaaaaaaaatcttactagaatgtttcattgtttcactgacagctttggcgatttgtgtttttcgtagttacgaattgttgttttttttttctgttgtttgctgcttccttggattgctaatcgctcatctaattgcagatttttgcaatggttcagcagttttgtcattatcgactaggcttataatttactctagagaagttttattagtgctagatattagcccgtgatgttacaggattagttttatattgccaattcttgagtgcaatcttcaactgtgaggttcttctttgacttgggatgctaaaatatctgttctgaatccatcgtaccacatagtgcgagtagtttgcttgaaatgcaaatctgaatatatggtaatattgagccgagatatgcaaccatgttggatctgttgaaccagagggttggagacaggaccagagagcatttcagaaaattcaattcctgccctgtgcatctacccaacatgcccacttggtcatcactcatatgctttcagaattgccagtctgtcctcgcataaaattgtttccaggtcatgatccacatattatgcatcataatagcacatgcaaactgttcatttgttggatcgctgtcagttctgtctaattccatgcttcagcaatctctgccaaccaattgacagtatagtcaatttaatatgtccgttcaagttttggatctattccgatgttgccattgattatatttgttgttagcgttctatgatcgaaattgcttcgagaaggcatcaaactaatgtaaaacagttcatttatagctctaacttgtggacccatgatcttaagctcatcgacccattatgtgtgtgagactttttctttacatcaagatggtacatggaacaccttttctgaatagcttattgtttgtgggtgaaggaaggttgaggctggactcaagaagtacaaaccagatattataattagtgtccaccccctcatgcaacacattcctctatgggtactcaaatggcaagggctacaaaatagagtggtctttgtcactgtcatcacagacctcaacacttgtcaccctacatggtacgtggaggctatccataagaaaaaacctggttatcttcttctgcaaaaacaattgtttctgttcaaaccattgaattaatcaatcggaaacattacaggttccatgctgatgtcaatagatgttactgcccatcggaagaagttgccaagagagcagcactggatgacctacaaccttctcaaatccgtgtgtttggccttccgattcggccatcattctgccgagccgttcttgttaaggtatgtgctccttatttaacttcaggactgttattccgatgcctgcgaattttttgtttcatatttgatctctcaaaaggtagatattcagtcgtggtattttacttgatctttcaataggtagatattcagtcgtggtattttatttgatcttgcagaatgtataggttatttatgcttttttatttaacatgcttaatgaatgctcttatcatggatttgtgctttgattaattgcaagcatgcataccccaaaagcattgctttaaatttaggatgtccattgactatattttaaaggaaaaatgacaaatttatgatagtgtggctgtacaatgatacacatcttaatacaaatgtgtagtatgcttttctatccactcaagtgttactttttttttaaaccaactcaccaggatgatttgaggaaggaacttgaattggatcctgagctgcctgcagtattgctgatgggaggtggagagggcatgggtcctgtcaagaagaccgcaaaagcccttggagagtcgttgtttgacaaggagcttggaaaaccaattggacagttaattgtcatttgtggtcggaacaaaacgctgagctcctcattgcaggctcttgaatggaaaataccaattaaggtatatgatagaaacgtgtgtttataataattctttttaagatgcagactgcttatcctcctatgttgaaacacatgttccttatcgacttcttttaacaaaaggttaggggatttgagacccagatggagaaatggatgggggcttgtgattgcattataacaaaggtatatccatgacattctatgattgttagcacgttatttcatacaaagatctctgtgtcattcttaaatcttaaatgttttttatgtttttatttgtctcaataggctggaccaggtaccatcgccgaagccttgattagagggttgcctatcatccttaatgacttcatacctggacaggttagggtctactaactttccgcggttattataaaagaacggtacgaatgtacatctatgttttatatggttattgactttgtggaccatacatatttaatactacaagggtgaatctcatgaaagttttatacgttaaataaaaaagatgtgtatgtgttttagaacttatttgtagcgtcagtgacactaatgttatgcagtgcacaaaataaatgattttttatcaagtgcgatatacagtatgtagcagttatatgatcacccagtggacatcatctaatgtaagtttgttctgcatggcaggaagttggcaatgtcccttatgttgtggacaatggtgctggtgtcttctccaaaagttctagggaaactgctaaacttgttgcccgctggtttggtccagattctgatgaactgaagaggatgtcagaaaaagcgttaaaactggctcagccagaagcggtgtttgatattgtcagagacatccatgagctatctcgggagcaaggggtgatttcacagatatccagttccttgacatcatcctttttcataccatcgccagaaaccacacctatacaacttatgtgaaaaatccgtgtatagctagaactgcattctttgacctcgtgaaatttgcctttgtcctacaatgtcctgaaaaagaaaaatatgtcaatggatttagctggtttgtttcatctgtctcacggcgttgggatgaggtaagcaggatttcgactgcttttcagtttgtggtctctcatggtagttatgggcttgtttgactgacagctgctcttgtgtaatatccatattcggtttttgttaaaatcattcgttcatatgattttttttaaaaaatcctgtcgtcctttgttcagagggaccagcgatgggctgcaaattgtacactgttagttgatgttggaaagtttaaacctctcgacttgtaacatatccattcatgtaagatccatcgtgactgtaaagtgtatgagacaatgacaaattgtgctagtgagagagtcatgtgcttgttgaagg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0802700, RefSeq:Os02g0802700