Difference between revisions of "Os02g0202000"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Expression)
Line 10: Line 10:
 
===Expression===
 
===Expression===
  
OsWR1 (Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.
+
OsWR1 (Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.As the expression patterns of the gene in different tissues might be associated with its function, we further investigated the expression of OsWR1 in different tissues of rice with Q-PCR. Our data showed that transcripts of OsWR1 were highly expressed in seedling leaves and stems, compared to these in seedling roots, whereas the expression of OsWR1 was mainly detected in leaves, blade sheaths, eustipes, internodes, testae and thrumb in the heading stage, indicating that the targets of OsWR1 might be expressed, at least partly, in the same tissues as the transcription factor.
  
 
===Evolution===
 
===Evolution===

Revision as of 11:49, 9 June 2014

Please input one-sentence summary here.

Annotated Information

The ethylene response factor (ERF) gene WIN1/SHN1 was shown to transcriptionally activate the expression of wax synthesis genes and wax production, resulting in drought tolerance in Arabidopsis. To further investigate the regulation of ERF proteins in rice, we started with homology search for rice genes in the National Center of Biological Informatics using the Arabidopsis WIN1/SHN1 as a probe and found 4 rice orthologues with high amino acid identities in N-terminal region. These rice WIN1-like genes, named rice wax synthesis regulator (OsWR), all encode ERF proteins that contain a basic N-terminal region that might function as an nuclear localization signal and an acidic C-terminal region that might act as an activation domain for transcription. OsWR1 (Os02g0202000) is one of them.

Function

Transcript analysis showed that OsWR1 is induced by drought, abscisic acid and salt, and is predominantly expressed in leaves. Functional analyses indicated that over expressing OsWR1 improved while RNA interference OsWR1 rice decreased drought tolerance, consistent with water loss and cuticular permeability, suggesting that OsWR1-triggered drought response might be associated with cuticular characteristics. In addition, OsWR1 activated the expression of the genes-related to oxidative stress response and membrane stability. Gas chromatograph–mass spectrometry analysis further showed that OsWR1 modulated the wax synthesis through alteration of long chain fatty acids and alkanes, evidencing the regulation of OsWR1 in wax synthesis. This WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.

Expression

OsWR1 (Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.As the expression patterns of the gene in different tissues might be associated with its function, we further investigated the expression of OsWR1 in different tissues of rice with Q-PCR. Our data showed that transcripts of OsWR1 were highly expressed in seedling leaves and stems, compared to these in seedling roots, whereas the expression of OsWR1 was mainly detected in leaves, blade sheaths, eustipes, internodes, testae and thrumb in the heading stage, indicating that the targets of OsWR1 might be expressed, at least partly, in the same tissues as the transcription factor.

Evolution

Sequence analysis of OsWR1 with WIN1-like.A: Whole amino acid sequence comparison of WIN1-like from Arabidopsis and rice. Asterisks represent the putative domain of the nuclear localization signal, the black line indicates the highly conserved AP2 domain, and double black lines indicate the putative activation domain. The shaded boxes indicate the percentage of sequences at this position with the same amino acid identity: black, 100%; and gray, 75%. Protein names are indicated at the left. B: Nucleotide sequences comparison derived from sequence alignment of ERF whole regions from Arabidopsis and rice

The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3 (57.8%) and OsWR2 (Os06g0604000, 81%), but low similarity to OsWR3 (Os02g0797100, 41.4%) and OsWR4 (Os06g0181700, 41.7%); these all contain the conserved ERF domain (Fig. 1a), suggesting that OsWR1 is ahomology of WIN1/SHN1. The WIN1-like members are conserved in gene structure because five of them (three from Arabidopsis and two from rice) contain a single intron positioned at 80–83 bp from the start codon, located from 80 bp in WIN/SHN genes, but from 83 bp in rice WIN1-like genes.The three odd nucleotides code the basic amino acid lysine (Fig. 1b). We reasoned that such sequence conservation with WIN/SHN genes, which were shown to participate in wax and cutin syntheses, might confer a similar function in rice.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0202000

Description

Pathogenesis-related transcriptional factor and ERF domain containing protein

Version

NM_001052761.2 GI:297598782 GeneID:4328653

Length

1051 bp

Definition

Oryza sativa Japonica Group Os02g0202000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:5688756..5689806

Sequence Coding Region

5688851..5688933,5689055..5689589

Expression

GEO Profiles:Os02g0202000

Genome Context

<gbrowseImage1> name=NC_008395:5688756..5689806 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:5688756..5689806 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtacagccaaagaagaagtttcgtggagtcaggcagcggcactggggctcctgggtctctgagatcagacaccccctccttaaaaggagggtgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaagaccaacttccccgtgcagaggaactccaccggtgatctcgccacggccgcagaccaggacgcccgtagcaatggcggtagcaggaactcctccgcgggcaacctgtcacagattctcagtgctaagctccgcaagtgctgcaaggcgccatctccgtccttaacctgcctccgcctcgaccccgagaagtcccacattggcgtgtggcaaaagcgcgcaggggcccgtgctgactccaactgggtgatgacggtggagctcaacaaagaggtagaaccaactgaacctgcagctcagcccacatcaacagcaacagcttcgcaagtgacaatggatgatgaggaaaagattgcgctgcaaatgatcgaggagttgctgagcaggagcagtccagcttcaccctcacatggagagggagagggtagctttgtcatctga</cdnaseq>

Protein Sequence

<aaseq>MVQPKKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAA RAYDEAAVLMSGRNAKTNFPVQRNSTGDLATAADQDARSNGGSRNSSAGNLSQILSAK LRKCCKAPSPSLTCLRLDPEKSHIGVWQKRAGARADSNWVMTVELNKEVEPTEPAAQP TSTATASQVTMDDEEKIALQMIEELLSRSSPASPSHGEGEGSFVI</aaseq>

Gene Sequence

<dnaseqindica>96..178#300..834#gttcagttcagaggcgcctagcaatagcagctcattgcctcatctctgcctcccctgtccttctgggggcagagaatctctccactgctggaaaaatggtacagccaaagaagaagtttcgtggagtcaggcagcggcactggggctcctgggtctctgagatcagacaccccctcctgtaagctcttctatcaacatccctctaattttctgctaataatgttatgttttgatgtgtctaatactctaatctaataagtaataagtctcaatgcatatggtgtttgcaactaatgcagtaaaaggagggtgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaagaccaacttccccgtgcagaggaactccaccggtgatctcgccacggccgcagaccaggacgcccgtagcaatggcggtagcaggaactcctccgcgggcaacctgtcacagattctcagtgctaagctccgcaagtgctgcaaggcgccatctccgtccttaacctgcctccgcctcgaccccgagaagtcccacattggcgtgtggcaaaagcgcgcaggggcccgtgctgactccaactgggtgatgacggtggagctcaacaaagaggtagaaccaactgaacctgcagctcagcccacatcaacagcaacagcttcgcaagtgacaatggatgatgaggaaaagattgcgctgcaaatgatcgaggagttgctgagcaggagcagtccagcttcaccctcacatggagagggagagggtagctttgtcatctgaaaggcttggatgaaacgacggcataacgaagtcaccactctagaccatggttccagaatttcctgctggtacacaggcagttcagattacttcagtacaatagaaaatatctattacttcagacaagtaacaagacatataagtttgcaactatgtgtagctatatgtgtttatgaaaagctatatatacgcagtctccatcaacatactttgttac</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0202000, RefSeq:Os02g0202000