Difference between revisions of "Os06g0604000"
Zhxbin2008 (talk | contribs) (→Expression) |
Zhxbin2008 (talk | contribs) (→Function) |
||
| Line 7: | Line 7: | ||
The Wax Synthesis Regulatory 2 gene (OsWR2) in rice (Oryza sativa L.) is highly expressed in epidermal tissues and contributes to the transcriptional regulation of both cuticular wax and cutin biosynthesis in rice cuticle. Overexpression of OsWR2 in rice increased the total cuticular wax level by 48.6%in leaves and by 72.4% in panicles. Of the major wax classes, aldehydes increased most in leaves, and alkanes increased most in panicles. Total cutin amounts were increased by 48.1 % in leaves and 65.9 % in panicles of rice overexpressing OsWR2, and these increases were due primarily to the increase inω-OH and di-OH acids. Our results showed that 19 genes previously associated with wax and cutin biosynthesis were up-regulated in OsWR2 overexpressors. | The Wax Synthesis Regulatory 2 gene (OsWR2) in rice (Oryza sativa L.) is highly expressed in epidermal tissues and contributes to the transcriptional regulation of both cuticular wax and cutin biosynthesis in rice cuticle. Overexpression of OsWR2 in rice increased the total cuticular wax level by 48.6%in leaves and by 72.4% in panicles. Of the major wax classes, aldehydes increased most in leaves, and alkanes increased most in panicles. Total cutin amounts were increased by 48.1 % in leaves and 65.9 % in panicles of rice overexpressing OsWR2, and these increases were due primarily to the increase inω-OH and di-OH acids. Our results showed that 19 genes previously associated with wax and cutin biosynthesis were up-regulated in OsWR2 overexpressors. | ||
| + | Overexpression of OsWR2 also altered cuticular wax crystallization and cuticlemembrane ultrastructure. Furthermore, OsWR2 overexpression in rice decreased leaf chlorophyll leaching rate, reduced water loss rate, and enhanced tolerance to water-limited conditions. We demonstrate in this report that OsWR2 regulates wax and cutin biosynthesis differently than does the OsWR1 homologue, and plays a major role in controlling cuticle permeability. The increased resistance to water deficit conditions by OsWR2 overexpression in rice elucidates a potential new strategy for genetic improvement of plant drought tolerance. | ||
===Expression=== | ===Expression=== | ||
Revision as of 12:39, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
The ethylene response factor (ERF) gene WIN1/SHN1 was shown to transcriptionally activate the expression of wax synthesis genes and wax production, resulting in drought tolerance in Arabidopsis. To further investigate the regulation of ERF proteins in rice, we started with homology search for rice genes in the National Center of Biological Informatics using the Arabidopsis WIN1/SHN1 as a probe and found 4 rice orthologues with high amino acid identities in N-terminal region. These rice WIN1-like genes, named rice wax synthesis regulator (OsWR), all encode ERF proteins that contain a basic N-terminal region that might function as an nuclear localization signal and an acidic C-terminal region that might act as an activation domain for transcription. OsWR2 (Os06g0604000) is one of them.
Function
The Wax Synthesis Regulatory 2 gene (OsWR2) in rice (Oryza sativa L.) is highly expressed in epidermal tissues and contributes to the transcriptional regulation of both cuticular wax and cutin biosynthesis in rice cuticle. Overexpression of OsWR2 in rice increased the total cuticular wax level by 48.6%in leaves and by 72.4% in panicles. Of the major wax classes, aldehydes increased most in leaves, and alkanes increased most in panicles. Total cutin amounts were increased by 48.1 % in leaves and 65.9 % in panicles of rice overexpressing OsWR2, and these increases were due primarily to the increase inω-OH and di-OH acids. Our results showed that 19 genes previously associated with wax and cutin biosynthesis were up-regulated in OsWR2 overexpressors. Overexpression of OsWR2 also altered cuticular wax crystallization and cuticlemembrane ultrastructure. Furthermore, OsWR2 overexpression in rice decreased leaf chlorophyll leaching rate, reduced water loss rate, and enhanced tolerance to water-limited conditions. We demonstrate in this report that OsWR2 regulates wax and cutin biosynthesis differently than does the OsWR1 homologue, and plays a major role in controlling cuticle permeability. The increased resistance to water deficit conditions by OsWR2 overexpression in rice elucidates a potential new strategy for genetic improvement of plant drought tolerance.
Expression
Overexpression of OsWR2 also altered cuticular wax crystallization and cuticlemembrane ultrastructure. Furthermore, OsWR2 overexpression in rice decreased leaf chlorophyll leaching rate, reduced water loss rate, and enhanced tolerance to water-limited conditions. We demonstrate in this report that OsWR2 regulates wax and cutin biosynthesis differently than does the OsWR1 homologue, and plays a major role in controlling cuticle permeability. The increased resistance to water deficit conditions by OsWR2 overexpression in rice elucidates a potential new strategy for genetic improvement of plant drought tolerance.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0604000 |
|---|---|
| Description |
Similar to Ethylene response factor 1 |
| Version |
NM_001064549.2 GI:297606135 GeneID:4341466 |
| Length |
1563 bp |
| Definition |
Oryza sativa Japonica Group Os06g0604000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:24775260..24776822 |
| Sequence Coding Region |
24775899..24775916,24776044..24776275,24776508..24776590 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:24775260..24776822 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:24775260..24776822 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgggacagtcgaagaagaagttccgcggagtcaggcagcgccactggggctcctgggtctccgagatcaggcaccctctccttaagaggagggtgtggctgggtacctttgagacggcggaggaggcggcgcgggcgtacgacgaggccgccatcctgatgagcggccgcaacgccaagaccaacttcccagtcgcgaggaacgccacgggggagctcacaccggcggctgcggtggcagggcgggatggccgtgtcggcggcggcagcggcagctcgtcctcaatgacggccaacggcggcgggaacagcctgactccagctgggtcatga</cdnaseq> |
| Protein Sequence |
<aaseq>MGQSKKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAA RAYDEAAILMSGRNAKTNFPVARNATGELTPAAAVAGRDGRVGGGSGSSSSMTANGGG NSLTPAGS</aaseq> |
| Gene Sequence |
<dnaseqindica>907..924#548..779#233..315#attgaacgcacgctacactgcaagaaaggcaagtataggggtggcaggtagtttatattcactggaaaccgagaacttcactcctcccagcactccacactaggaggatgctcactgtctgactgactgactggctgctgctgctgctcattccttctcctactctgcctgcctcctctgctgtgtccttgggagaattcttcagggacagtatccctgcagaggtgagatcatgggacagtcgaagaagaagttccgcggagtcaggcagcgccactggggctcctgggtctccgagatcaggcaccctctcctgtaagtctctatctcactagtgatgatcactagctagctatgttgctctgatgtgttatgccactgtcgtgatagatacattttgatggatagctagtggttctggtttgttgttgctttctttctttttttctttctctttcatggtatgttagtagctaactcaaggtgcttgggtgcgtgcatgcatgaatgatggatgatgttttttttgctacgtgcgttgtggcagtaagaggagggtgtggctgggtacctttgagacggcggaggaggcggcgcgggcgtacgacgaggccgccatcctgatgagcggccgcaacgccaagaccaacttcccagtcgcgaggaacgccacgggggagctcacaccggcggctgcggtggcagggcgggatggccgtgtcggcggcggcagcggcagctcgtcctcaatgacggccaacggcggcgggaacagcctgtctcagatcctcagcgccaagctccgcaagtgctgcaagacgccgtcgccgtcgctcacctgcctccgccttgacccggagaagtcccacattggcgtctggcagaagcgcgccggcgcacgcgctgactccagctgggtcatgaccgtcgagctcaacaaggacacggccgtgtcgtcggctgcgacggtggcagcagcaacagcagtgtcgtccagcgaccagccgactccgagtgacagcacagtcacaacgacgtccacgtccaccacgggctcgccgtcgccaccacctccggcaatggacgacgaggagaggatcgcgctgcagatgatcgaggagctgctgggcaggagcggcccgggctcgccgtcacatgggctgctgcacggtggtgaaggtagcctcgtcatctgaattccggaagaacaggaaagaaattgaaaatgcaaggttaaaacagcatgatcaggtcaccatctaagatcaaggatctggtagggtggttggtgcacaggcagttaagattgctacatatgataggtatatctctattactactacatatccagcttaattaggaaacaattataagatcgattactactgtgtgaagtgaagctgtgtatttattaaagacttacttgtatgtacaagacgtccccgtcattatagtcatactggtgaaagctctgctatgtatcaacgtcatcagagatcagactacatatatataagtggtgtcaacttctaataaaagtaaataaaaacattgtaattgtgt</dnaseqindica> |
| External Link(s) |
