Difference between revisions of "Os02g0181300"
Hanweifang (talk | contribs) (→Annotated Information) |
Hanweifang (talk | contribs) (→Expression) |
||
| Line 8: | Line 8: | ||
===Expression=== | ===Expression=== | ||
The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines. | The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines. | ||
| − | |||
===Evolution=== | ===Evolution=== | ||
Revision as of 17:10, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
WRKY proteins constitute a family of mostly plant-specific zinc-finger transcription factors composed of 74 and 109 members in Arabidopsis and rice, respectively.A common feature of WRKY proteins is the WRKY domain, which is defined by a region of approximately 60 amino acids containing a conserved WRKYGQK amino acid sequence adjacent to a zinc-finger-like motif.Both regions are necessary for high-affinity binding to a canonical Wb-box motif containing a consensus sequence (C/T)TGAC (C/T). Based on primary structure, WRKY proteins have been classified into three groups (I, II, and III) and various subgroups (e.g., IIa, IIb, etc.)
Expression
The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0181300 |
|---|---|
| Description |
WRKY transcription factor 71 (Transcription factor WRKY09) |
| Version |
NM_001052629.1 GI:115444628 GeneID:4328512 |
| Length |
1393 bp |
| Definition |
Oryza sativa Japonica Group Os02g0181300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:4543031..4544423 |
| Sequence Coding Region |
4543031..4543177,4543287..4543709,4543836..4543952,4544064..4544423 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:4543031..4544423 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:4543031..4544423 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</cdnaseq> |
| Protein Sequence |
<aaseq>MDPWISTQPSLSLDLRVGLPATAAVAMVKPKVLVEEDFFHQQPL KKDPEVAALEAELKRMGAENRQLSEMLAAVAAKYEALQSQFSDMVTASANNGGGGGNN PSSTSEGGSVSPSRKRKSESLDDSPPPPPPPHPHAAPHHMHVMPGAAAAGYADQTECT SGEPCKRIREECKPKISKLYVHADPSDLSLVVKDGYQWRKYGQKVTKDNPCPRAYFRC SFAPACPVKKKVQRSAEDNTILVATYEGEHNHGQPPPPLQSAAQNSDGSGKSAGKPPH APAAAPPAPVVPHRQHEPVVVNGEQQAAAASEMIRRNLAEQMAMTLTRDPSFKAALVT ALSGRILELSPTKD</aaseq> |
| Gene Sequence |
<dnaseqindica>1..147#257..679#806..922#1034..1393#atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggtaggtcatgtgattaagcatacgtgcacggacgatcgacggccgccatggctgggagcgtgatgagcttaatttcttgagctgatttggggttttttttgttgtgaaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtacgaatccccaaccccaattaacatccgatcatctcatttcatgtgcctaacttaacttctttttgttctgaattctagccttgattaattaattaatcctgttcttgcaatgaatccatgcaggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggtaacttaaattcctctaactaattccaaagtgatttcgtaagttttgctaaatttagtgcaaattcgagcctgtttctgaactttgttcgtggttcaaatgttgtttcaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</dnaseqindica> |
| External Link(s) |
