Difference between revisions of "Os06g0127100"
(→Function) |
(→Expression) |
||
| Line 7: | Line 7: | ||
===Expression=== | ===Expression=== | ||
| + | |||
In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response. | In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response. | ||
| + | Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7). | ||
| + | [[File: li-Os06g0127100-Fig1.jpg|right|thumb|200px|''Fig1.Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7). (from reference <ref name="Akhter Most Sharoni" />).'']] | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 00:46, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Conserved amino acid residues and phylogeny construction using the AP2/ERF conserved domain sequence suggest that in rice the OsAP2/EREBP gene family can be classified broadly into four subfamilies [AP2, RAV (related to ABI3/VP1), DREB(dehydration-responsive element-binding protein) and ERF (ethylene-responsive factor)](Akhter Most Sharoni, 2010).The chromosomal localizations of the OsAP2/EREBP genes indicated 20 segmental duplication events involving 40 genes; 58 redundant OsAP2/EREBP genes were involved in tandem duplication events(Akhter Most Sharoni, 2010). Os06g0127100 comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.It is highly up-regulated in both genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes.
Expression
In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response. Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0127100 |
|---|---|
| Description |
Similar to CBF-like protein |
| Version |
NM_001063196.1 GI:115466123 GeneID:4339974 |
| Length |
764 bp |
| Definition |
Oryza sativa Japonica Group Os06g0127100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:1433771..1434534 |
| Sequence Coding Region |
1433798..1434442 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:1433771..1434534 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:1433771..1434534 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MEYYEQEEYATVTSAPPKRPAGRTKFRETRHPVYRGVRRRGPAG RWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPA TLATPDDIRRAAIELAESCPHDAAAAAASSSAAAVEASAAAAPAMMMQYQDDMAATPS SYDYAYYGNMDFDQPSYYYDGMGGGGEYQSWQMDGDDDGGAGGYGGGDVTLWSY</aaseq> |
| Gene Sequence |
<dnaseqindica>28..672#ccagcagcagcaacacacactactgacatggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactgatgatcgcgagttggagctagcagttttgagctcaaccagctttgctcctcctatacagctaaatactgtaggagaaattaatggagattttt</dnaseqindica> |
| External Link(s) |
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedAkhter_Most_Sharoni