Difference between revisions of "Os09g0106700"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
   ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii) unlike its homologs in rice, even under saltstress condition.
 
   ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii) unlike its homologs in rice, even under saltstress condition.
 +
 
===Expression===
 
===Expression===
 
The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight. Expression of ''PutAKT1'' increased the K+ content under normal K+ -starvation,and NaCl-stress conditions. Expression of ''PutAKT1'' also showed a decrease in Na+ accumulation both in the shoot and in the root.  
 
The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight. Expression of ''PutAKT1'' increased the K+ content under normal K+ -starvation,and NaCl-stress conditions. Expression of ''PutAKT1'' also showed a decrease in Na+ accumulation both in the shoot and in the root.  

Revision as of 01:55, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

 PutAKT1 is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii) unlike its homologs in rice, even under saltstress condition.

Expression

The expression of PutAKT1 was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing PutAKT1 showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight. Expression of PutAKT1 increased the K+ content under normal K+ -starvation,and NaCl-stress conditions. Expression of PutAKT1 also showed a decrease in Na+ accumulation both in the shoot and in the root.

Evolution

PutAKT1 belongs to the AKT1-subfamily in the Shaker K+ channel family. PutAKT1 was localized in the plasma membrane and it was preferentially expressed in the roots.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0106700

Description

Similar to Myb proto-oncogene protein (C-myb)

Version

NM_001069097.1 GI:115477933 GeneID:4346379

Length

1586 bp

Definition

Oryza sativa Japonica Group Os09g0106700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:603500..605085

Sequence Coding Region

604001..604960

Expression

GEO Profiles:Os09g0106700

Genome Context

<gbrowseImage1> name=NC_008402:603500..605085 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:603500..605085 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaa</cdnaseq>

Protein Sequence

<aaseq>MMASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLIS KSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRT DNAIKNHWNSTLKRKHHSSLLADDLRPLKRTTSDGHPTLSSAAAPGSPSGSDLSDSSH HSLPSQMPSSPPHLLLPQHVYRPVARAGGVVVPPPPPPPPPATSLSLSLSLPGLDHPH PDPSTPSEPAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPPPPRPSAPFSAEFLA MMQEMIRIEVRNYMSGSAAVDPRSSPDNGVRAASRIMGMAKIE</aaseq>

Gene Sequence

<dnaseqindica>126..1085#ctgacttaatttagctccgcctccattcacgcattcacactagcatagcatataagatagcacttgtagagaggagatactagtacacatagagaagaggagaggagattgatcggtgagggaggatgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaatcaaccagccgcagcagcatacggaatgatcgagtaatcaagctcagattgatgcactgcaagcaagaaagcagagcaagaagcagaggcgccggcgcggcaagtgaagagacgacgaccatcaacgtttggatcctccttttctattctgctatagtcttcttcttccccaataattccttgtctagttttaatttttttttctcttcaatttttactcctccaatccaagttgaagttgtcactagtagagttctccagagagagaggagatgaagcaacaacaaggagctgtgtctgcctgtctggaggaactaataccaaaccaaaataagcagagtgtgtgctgctgtgccacaatcagcaccaccaccgtggcaccacccactagcttagcttagctagctagttcaaagttctttttgtatatacttataagaggaaaaagaaaaaagagagctgatcagtgaaaattcagaatgcatcagtgaagagaattgc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0106700, RefSeq:Os09g0106700