Difference between revisions of "Os10g0536100"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 41: Line 41:
 
==References==
 
==References==
 
1. Choong-Hwan Ryu;Shinyoung Lee;Lae-Hyeon Cho;Song Lim Kim;Yang-Seok Lee;Sang Chul Choi;Hee Joong Jeong;Jakyung Yi;Soon Ju Park;Chang-Deok Han;Gynheung An OsMADS50 and OsMADS56 function antagonistically in regulating long day (LD)-dependent flowering in rice Plant, Cell & Environment, 2009, 32(10): 1412-1427
 
1. Choong-Hwan Ryu;Shinyoung Lee;Lae-Hyeon Cho;Song Lim Kim;Yang-Seok Lee;Sang Chul Choi;Hee Joong Jeong;Jakyung Yi;Soon Ju Park;Chang-Deok Han;Gynheung An OsMADS50 and OsMADS56 function antagonistically in regulating long day (LD)-dependent flowering in rice Plant, Cell & Environment, 2009, 32(10): 1412-1427
 +
 
2. Jongmin Nam;Kerstin Kaufmann;Günter Theißen;Masatoshi Nei A simple method for predicting the functional differentiation of duplicate genes and its application to MIKC-type MADS-box genes Nucleic Acids Research, 2005, 33(2): e12
 
2. Jongmin Nam;Kerstin Kaufmann;Günter Theißen;Masatoshi Nei A simple method for predicting the functional differentiation of duplicate genes and its application to MIKC-type MADS-box genes Nucleic Acids Research, 2005, 33(2): e12
 +
 
3.Peng L.T., Shi Z.Y., Li L., Shen G.Z. & Zhang J.L. (2007) Ectopic expression of OsLFL1 in rice represses Ehd1 by binding on its promoter. Biochemical & Biophysical Research Communications 360, 251–256.
 
3.Peng L.T., Shi Z.Y., Li L., Shen G.Z. & Zhang J.L. (2007) Ectopic expression of OsLFL1 in rice represses Ehd1 by binding on its promoter. Biochemical & Biophysical Research Communications 360, 251–256.
 +
 
4.Arora R., Agarwal P., Ray S., Singh A.K., Singh V.P., Tyagi A.K. & Kappor S. (2007) MADS-box gene family in rice: genome-wide identification, organization and expression profiling during reproductive development and stress. BMC Genomics 8, 242.
 
4.Arora R., Agarwal P., Ray S., Singh A.K., Singh V.P., Tyagi A.K. & Kappor S. (2007) MADS-box gene family in rice: genome-wide identification, organization and expression profiling during reproductive development and stress. BMC Genomics 8, 242.
 +
 
5.Lee S., Kim J., Han J.J., Han M.J. & An G. (2004) Functional analyses of the flowering time gene OsMADS50, the putative SUPPRESSOR OF OVEREXPRESSION OF CO1/AGAMOUS-LIKE 20 (SOC1/AGL20) ortholog in rice. ThePlant Journal 38, 754–764.
 
5.Lee S., Kim J., Han J.J., Han M.J. & An G. (2004) Functional analyses of the flowering time gene OsMADS50, the putative SUPPRESSOR OF OVEREXPRESSION OF CO1/AGAMOUS-LIKE 20 (SOC1/AGL20) ortholog in rice. ThePlant Journal 38, 754–764.
  

Revision as of 03:26, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsMADS50 and OsMADS56 , which is highly homologous to Arabidopsis SOC1, are affected by the circadian clock.OsMADS50 serves as a flowering activator by controlling various floral regulators such as OsMADS1, OsMADS14, OsMADS15, OsMADS18 and Hd3a. OsMADS50 is a flowering activator that functions only under LD conditions. But OsMADS50 and OsMADS56 function antagonistically in regulating LD-dependent flowering by controlling expression of OsLFL1 and Ehd1. So OsMADS56 is an LD-specific floral repressor.OsMADS50 and OsMADS56 form a complex that regulates downstream target genes in order to regulate the Rice's flowering time. OsMADS56 is highly homologous to OsMADS50. OsMADS56 is located on chromosome 10, and consists of eight exons that encode a typical MIKC-type MADS-box protein (Fig. 2a). When their full-length protein sequences are aligned, this MADS-box protein shares 60.8% homology with OsMADS50. This implies that OsMADS56 may also regulate flowering time.

                       Fig2a.jpg

Expression

(1)Using the maize Ubiquitin promoter in transgenic plants that over-expressed OsMADS56 (56OX; Fig. 2a). Among 17 primary (T1) plants, 9 flowered late by 1–2 weeks in the paddy field. RT-PCR analyses of three normal plants (#4, 19 and 20) and five late-flowering plants (#6, 8, 10, 11 and 13) demonstrated that the extent of late flowering was correlated with OsMADS56 transcript levels (data not shown). Then selected Lines 8 and 10 for further analyses of the next generations when grown in controlled environments. Both lines displayed a dominant late-flowering phenotype under LDs. Homozygous progeny flowered late by 3–4 weeks under LD (Fig. 2b,c), although no significant change was observed under SD (Fig. 2d). These results suggest that OsMADS56 is an LD-specific floral repressor. They observed no other phenotypic changes in this overexpressor except for the delayed-flowering phenotypes.

Fig2b.jpg Fig2c.jpg Fig2d.jpg

(2)Real-time RT-PCR analyses indicates that OsMADS56 transcript levels were low at the seedling stage but gradually increased to a maximum at 4 weeks after germination as the observation made by CHOONG-HWAN RYU1 etc. (fig.3b) (3)OsMADS56 and OsMADS50 control the Rice's flowering time through regulating their communal downstream genes OsLFL1-Ehd1 .The expression patterns of Ehd1, Hd3a RFT1 and OsLFL1 reveal it.(fig3c-f) (4)The mRNA levels of OsMADS50 and OsMADS56 along with other flowering regulators such as Ehd1, Hd1 reveals that OsMADS50 and OsMADS56 also have daily rhythms.(fig9) The transcript levels of them is similar to that of Ehd1. (5)OsMADS56 is located on chromosome 10, and consists of eight exons that encode a typical MIKC-type MADS-box protein.

 F3b-f.jpgFig9.jpg

Evolution

Please input evolution information here. Although the osmads50 null mutant plants flowered late, they did eventually bloom after 2 months. This indicates that other positive regulators induced flowering in the absence of OsMADS50.OsDof12 functions independently from OsMADS50 as a positive regulator of Hd3a under LD-specific conditions.Unlike the osmads50 mutants, suppression of OsID1 causes extremely late flowering under LDs.

Knowledge Extension

In those Ehd1-RNAi plants, mRNA levels of both OsMADS56 and OsMADS50 were unchanged,indicating that OsMADS50 and OsMADS56 are upstream of Ehd1.Transcript levels of OsMADS56 were not altered in OsID1-RNAi plants , indicating that OsMADS56 is not hypostatic to OsID1. The level of Hd1 transcript was not affected in osmads50mutant and 56OX transgenic plants. T-DNA insertional knockdown plants for Hd1 reveals that mRNA levels of these two MADS genes in the mutants were unaltered under both SD and LD conditions,thus the LD-flowering pathway mediated by these two MADS genes is independent of Hd1. You can also add sub-section(s) at will.

Labs working on this gene

1.CHOONG-HWAN RYU1 ,Department of Life Science and Functional Genomic Center, Pohang University of Science and Technology (POSTECH), Pohang 790-784, Korea

2.SOON JU PARK2&CHANG-DEOK HAN, Division of Applied Life Science (BK21 Program), Plant Molecular Biology and Biotechnology Research Center (PMBBRC), Gyeongsang National University, Jinju 660-701, Korea

3.Nam J,Institute of Molecular Evolutionary Genetics and Department of Biology, Pennsylvania State University University Park, PA 16802, USA

4.Lee S, National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology (POSTECH), Pohang 790-784, Korea

5.Kaufmann, Melzer & Theissen , Friedrich-Schiller-Universität Jena, Lehrstuhl für Genetik, Philosophenweg 12, D-07743 Jena, Germany.

6.Takada S. & Goto K,Research Institute for Biological Sciences, Okayama 716-1241, Japan

References

1. Choong-Hwan Ryu;Shinyoung Lee;Lae-Hyeon Cho;Song Lim Kim;Yang-Seok Lee;Sang Chul Choi;Hee Joong Jeong;Jakyung Yi;Soon Ju Park;Chang-Deok Han;Gynheung An OsMADS50 and OsMADS56 function antagonistically in regulating long day (LD)-dependent flowering in rice Plant, Cell & Environment, 2009, 32(10): 1412-1427

2. Jongmin Nam;Kerstin Kaufmann;Günter Theißen;Masatoshi Nei A simple method for predicting the functional differentiation of duplicate genes and its application to MIKC-type MADS-box genes Nucleic Acids Research, 2005, 33(2): e12

3.Peng L.T., Shi Z.Y., Li L., Shen G.Z. & Zhang J.L. (2007) Ectopic expression of OsLFL1 in rice represses Ehd1 by binding on its promoter. Biochemical & Biophysical Research Communications 360, 251–256.

4.Arora R., Agarwal P., Ray S., Singh A.K., Singh V.P., Tyagi A.K. & Kappor S. (2007) MADS-box gene family in rice: genome-wide identification, organization and expression profiling during reproductive development and stress. BMC Genomics 8, 242.

5.Lee S., Kim J., Han J.J., Han M.J. & An G. (2004) Functional analyses of the flowering time gene OsMADS50, the putative SUPPRESSOR OF OVEREXPRESSION OF CO1/AGAMOUS-LIKE 20 (SOC1/AGL20) ortholog in rice. ThePlant Journal 38, 754–764.

Structured Information

Gene Name

Os10g0536100

Description

Transcription factor MADS56

Version

NM_001071703.1 GI:115483149 GeneID:4349237

Length

10441 bp

Definition

Oryza sativa Japonica Group Os10g0536100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:21318476..21328916

Sequence Coding Region

21318861..21319045,21325700..21325778,21327505..21327566,21327666..21327765,21327903..21327944
,21328060..21328101,21328414..21328517,21328527..21328605

Expression

GEO Profiles:Os10g0536100

Genome Context

<gbrowseImage1> name=NC_008403:21318476..21328916 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:21318476..21328916 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgcgggggaggacggagctgaagcggattgagaacccgacgagccggcaggtgaccttctccaagcgccggaatggcctcctcaagaaggcgttcgagctctccgtcctctgcgacgccgaggtcgccctcatcgtcttctccccccgcggccgcctctacgagttcgccagcgcccccagcctacagaaaaccatcgaccgctataaagcatacacaaaggatcatgtcaacaataagacaattcaacaagatatccagcaagtcaaagatgatactttaggcttggccaagaaacttgaagctcttgatgagtccagacggaaaatattgggagaaaatttagaaggattctctattgaagaactgcgtggtctagaaatgaaacttgagaagagcctccacaagataagactaaagaagaccgagcttctggagcagcagatagccaagctgaaagagaaggagcggactttgcttaaagacaacgaaaatttacgcggaaagcatcgcaaccttgaggctgcggcgctggtggctaaccacatgacgacgacgacggcgccggcggcgtggccgcgggacgtgcctatgacgagcagcacagccggcgccatggacgtggagactgatctgtacattggattgcccggcactgagcgctcctccaaccggtcggagacaggttga</cdnaseq>

Protein Sequence

<aaseq>MVRGRTELKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVA LIVFSPRGRLYEFASAPSLQKTIDRYKAYTKDHVNNKTIQQDIQQVKDDTLGLAKKLE ALDESRRKILGENLEGFSIEELRGLEMKLEKSLHKIRLKKTELLEQQIAKLKEKERTL LKDNENLRGKHRNLEAAALVANHMTTTTAPAAWPRDVPMTSSTAGAMDVETDLYIGLP GTERSSNRSETG</aaseq>

Gene Sequence

<dnaseqindica>386..570#7225..7303#9030..9091#9191..9290#9428..9469#9585..9626#9939..10042#10052..10130#cgccctcgtctcgtctcgtctctccactcccccacctcccatccgctactgctagtactactactacccggcctctcgccttctcgcgcggccgcgatttccgttcgcaaatccgcacccacggcggcgcgaggtcgccgtcgtcgtcgagccatttcgggtgagagggggggtctccggtttttctcagatctgtccacttttgtccagttttgatctggtgatttaatatactatttttcacttctggtggtttgcggcgacgcgtgtgcaggggggtagtttataagggcttgcgcgaggagggggaggagtagcgggtagcggcggctcgagtcgagtcgtcgtcgtcgtcggcggcggcggtcgagagagatcgggatcgatggtgcgggggaggacggagctgaagcggattgagaacccgacgagccggcaggtgaccttctccaagcgccggaatggcctcctcaagaaggcgttcgagctctccgtcctctgcgacgccgaggtcgccctcatcgtcttctccccccgcggccgcctctacgagttcgccagcgcccccaggtataccttcttctcgttctcggcaagttctcgccggaaattattctctcgctcgtttcgccctcgtcgtgctgctgcatcaaatgcaaatgcgatttcattctctctctctctctctgtggtaatcgggtgatttttgtggtttggggggtttgaggattcggctgttgggattgcttgttcgtcagagtttgaattcctgcccttaattccgtcgaacaaaaatgggttctctgttcggatttggcacctgcggatttggccaccgctgctgcgacgacgaagacgacggcgacggcgaccgccggccacacacactactagtagcctactagttcgtcttgcttctcacttgctattattgttattattggaagctgtgaactcctgtagaagttgaccccttctctccccctaaatatctgtacggccctggagaccggatggatatgcccacacctcagcactctctcacagtcaccaccagttgcctgtagtatctcttcttcattcatcttcttcttcctctcacatgttaacaactgttccatggagcatgtccacgagctctggattgattctctggcgcgtctctgtgcatcttccttccccattcgtcgattcttgttctcgatccgcgggaaaattgacgattaaaggaggctcctgacctctgaataaaatcaaggacaaaaacgtacaagaaggcagaggtaataaacccaagatagccaatatacaaagaaaaaccaaagtaaatggcagccaatgggaggaaggaggccggccggcgtgcgtggccagtaattgcggggtaggaagaaggctgcgagcctgcgagcgtgcgagactacaaatggagaaacaagctaatgtgacatccggtcagtgagatgagagatcattgggcgcctacctgcaccctctctctctctctctcgatccacaccactgcactgctcccctctcgatcgtacactggctgatgagctagccaagttgatttctctcgcaaaacgtaccacggattggtcgcatcagctccgttcgtcgagggtatggtgtgggggtatctttccatcatacacagtatgacgttggccacagtacatagcatgcgatatggctgtttctgaatattttttcagttttcagcaggtccgaatttgttaggtggaaccgtgatttatatatttctcccctcttccttgtggatatagtactcgtattgtgtatcttactcctagttctcttgcacccactccagctggagagtggagagagtggagagtacgtaccttatctggcgcacactgtactataatccttatattttggtgatcaggtgcaccgtttattatagattaatcatcatctcttagacatggcttgttgcaccttaatatccatctctttatcaggcttatatgtctacggcagtgaaaaagcgttgccagttaattcattgtcgtgcatgtagtttccaaaccatagtctagggaacactcaatgttgttccatgatattaagtgatgttaagtactccataacttaattagtactccatgccaatactcgacaacataatatttccatcacacttcatatatatgtatgctctccctctttctcaattaggaagatctatctagaaaattcttgagtttgcaagctatgatatgcaacgaactttcttctaatgtaagtgcaaaactatggattgtcattcattacttacgttacttcttaataaacattatcaagaagctagattgtagagcatgtaaagctgagtggaaaaggagttttggtaagcatgtgattgacatgtcttataggtcgtcgattgatctgcccaaacaacagtacaaatgaagttaattctactgtgaatagcatgtgataactcgcaatccgtagaatgctttggctttaaaacaataattttaagagtgtgagcaatgcttatgttacttcatcagattatcgtgtgccttaattcttatctgttgatcatatttagtactcctcctacccataaatatatgaacacttgaagcatttaaaatttatccacaaatatgatgattattcctagagtactactgatccctcttcccaaaataagtgaccaatttggatgtaaaatttgtttcaagataagtgatcacattacagtgctacttgtctattaatcacctcttgttcaaacttcttatcttacctcaactaccctcccacttctaaacatccctcatttaggtcatttgcctttcctcattatttggctcatatataagtgataaagtagcttattcatttattttagaacagatcgatggagtacttattacaacaatcacccgtcattcaaatttctttctaacttacactcaaccaccgtcccacctccatctctctatcttctcctccaactctctctcttttaatgaggggcaccaaaatattttcttctcaactttaatctctactaaacaatttggcatgtgtatatttgttaatggagggagtattttctaagttctaagtacttgatatatatcgtttaaccagaaatctatacctatgtgaaaaaaatacattgtccatagatcgatctttcatgagtatattactgaatcatgccaaatttggccaatgttacatattaattatgatcttaaagtttgttctgaaattactttgccttgaatcttccaagcaagtatatatatacgtgtaggcaccacacttctcatggtcaaatttagatatttatcaacctaattagtcagtccatatatagagagttaatgcaactagctagttgctttgtctaatgtgagatcttttgtacgtgaactgtaaacattatatatacaacctccatcctatattacttgtcgctttgagtttttatttgtaatgtttgatcattcgtcttattcaaaaattttttacaattgttatttattttatttgtgatttgctttattatcaaaagtattttaaatatgacttatcttttttatatttgcactaatttttcaaataaaacaaagggtcaaacgttgtaacgaaaaagtcaaagcgacatctattatgagacggaggtagtatgatcggtgtgctgtctttagtcctgtttaagatacttaatttctctgaaatacaattgctcataattacagtgttgttgtcagttttgtcttcttttccaaatactttatttgaaatatggataaatcaaacttaccttttaccctaataaactacactatacatactaatcttaataacatttatgcataacatttatggtttttgttcattcttttcaaatccgttccattctgggcagaatggggcaatgcaagtactgtcacaaagaacaaagaacagatggtgcagccggatatgcatatatatataccagctgaatttttggccgtttcaggaaaacttcaatttaaaatcaatgttggtactatcaaattaatagctgcaaagtctccactaggtctagcaagaaagtagcagctcaatggtagtaataacttcatatgtttatcgaacagatattagctttctttaaaagtccattaccaaacaaggcttatctaggggcatagtacccccatagacccatatgtaggagtaacaaagagaaaatgattaattacaaatattttaatgggcttgtttggcagggctccaactctaagtactagctaaattctgttctacctctctagttcattttataaaagcactctagcattctcctctctctttgtaggtggagctgaaaccgtttggttgggctctagctcaaggagaggtggagttggagctttgccgtatgggcccaatgtatataaaaaatatctataatttggttatagagtatttgtatttcaatgggaaaaaggtatatgtgttaatagtattatactcttctcataaaaatgagtgtgaaactaacttttgtaataatccttactattagttagctgagctcgaactattctttagtgtacaggcaacacgccccaattctacaagtgctgcaaccaaagctttcaatactggttttgccggaaatacccgtaccgcttgctggttgttacttcttccgtttcataatgtaagtcattctaacattgcccacattcatacaaatgttaatgaatctagacataaacatatgactagattcattaacatctatatgaatgtgggcaatgctagaatgacttacgttatgaaatggagggagtattagacaaatgttcaaatctaaaattttgaactcactgtggttcagtaacctgcaggcagagaaaaacagcatgattgaaagcacagttttgcataaacaatacatcgcaagtagatgaaaactattaaaacataatcatcaataatgatctgaccagtctaaaaaaatcaataatgatacgcatcaatagatataagtccatcatgaacaatcataatgcaataatccatcacaaaacccctacatagggcataccacaatattattccttctcaaattgtaattcaaggtataacacaatttcacagcacacataaatatcttattgatcttttctctctttccattagagatgtacctacagataacccttcaaagtgaagataaattcatatataaattttcaaatatgtttttctagattttcaaattataaaataaactgtcccaggcagttactagacgttgagatttctaacatggttgtgccatcaatggctgtttaatttctgtacatattacataacatatagtagggttgtcaatgagctgaacttgagcacatggcacatcaatttcgttttcaagttgaatgaatgatctaaattgaccttgagtgaacctgagttggtgccaacaaccgatgttgaaggtatgctcttgctaaaatttaattgaaaacttgagctttagcccgataaggtcacacgaactctatttatgcatgtctgaatgtgtttcatgcaaaaaagaaaaggcatggccaataatttcgaatccataaggcttgttagcttacatgtgttatccttcaatgaaaattatattctatattggacaaggtttcgattcttgttggtttatatggttgaaacttttatgcttggaacaattcctacctgatgaatcttgttattattcccaaagaatagccaaatacaatatatttgtttctactatataacaactacattttggcaagtcaataatttttttttgcgaggaggctagtcaataattaagtaggcacactcctatgcacgccaatcagattatgttgattcagaaacatgcatgcgcactgcacataagattgctcattgaggtagttgcattatttatttagctaagatattgccagcatggcaatgaagcagatatgatgaaaatggaggatccagaatatatatcctcagcttttttttccaattatcaaaaagtttaaaccatcactaggaagagtgaagctcttgcattgttcatttaattaggtggacaacagaaggaacagttcagtttcataatatatagcggtcaagaaaaagtttcatattatatataatacatgtgattttgcgacttgatacatttatcgtagtatccattattcttgttaaactgagcctgccctgcctatggaatgattacctgaaatattattttagtggaactcagttatgccttttatattttattaaaaagatagaatttgagtttgtgtcccaattttttgttaccaggaaagattctaaaaaaactcaaaagatgttgactatctaatctttttgaacaagatagatacttagaaccaaatttacacaaagaataaagcattttaaaatgtaatacaagtagatgtatttcctagtctggtttgaactgcatacaaaaacaaaattgctccaaaggatgtctgtcatactggcaaatgtagacatgcttcttgaaaaagttggctcaaagatggtcaattatgcaatgtttttttttcaaataaatatatattttttaacatatgtactgaaattgaacgttttgtgatatacacagaacatgcaccagtttaacttgcagtcctgaattttattgatgtttaagtgcttgcgttcacttattggtaactatagaacgtccatgcatgtgctatcgtgtgtacagcttgggatgtaacatctgaattatgatataataaatatctaggaaggtaacaaaatgttcctcgctagtgctggtgttgatatattttcagagaaagctggaagcgcaactgtcaaatcaacagccgcctattggcattgaaacatacatatctacctctcgttgtttctacttttttttggcaagaatttggttggatatagttggccataggcctgtagccaccactgtttgtagcatcgcaatatgcacagacaaacatttgagctgctgagctagcagagctagctagtttattgtagcaggttggaacaagcacagctagctcaagtcatgcatgcactaataaattagagtatgtatgttttttgccccagaacgattatatcatcgatcttctgatttttagtttgctccttgtgtctgttctgcagcctacagaaaaccatcgaccgctataaagcatacacaaaggatcatgtcaacaataagacaattcaacaagatatccaggtgaatatcttgcctccacacacaatccgcatatatcatgcaacatatgaaaactatttccttctttttatgttgacgagttcttgcgtgatgcagaaggtactgcaatttagcaattaatggcacaattttatattgctgacttttaactttctggcatgcattttaacgtagcaatggcgtgtttgttaatatagctctagactctaggattacaagaaaacagaatgtccctagctctctagacttggcggttgggcaacagaataattagccttggtggttttcagtctatacttggcggttttcgaccgccaagaacattctgttttcttgtagtgtggtgtggtacattttgcggcatcttcagtttttttttttgaaagttgcatcttcagttattagtgctagcttagctaagagaacatactgcagttaatttagcaataaaagtacaaagtaccaaacacattgtaaagtagcgctacatgtaacatgttcatcagctgatcggttgttgggagtcctattaatttgccattggtatgtctattaattaaactagatgaataccccgccgcgttgctgcgggaaattaagttacataatatgtacatatatgatgcaatataattattaaaactaaacaaattggtacttatgaattttgagcctataaataattgagattgcatggtgttatgagagaagaaagaagagacaatttgaaccatagatctatcatccaaaggctagaaataattgggatgatgtggcttaatgagagaagagagaaatagtaataactacacttagtgtggatgaactatataagtagggatgaaaacggtcggaaacgatcggaaaacaacctcaaccatttccataatcatatttttctcggaaatgaaatcaaaaacggtaaagtcggaaacgaaaatgatatcggaaatatcggaaaaccggaaacggaataatacggacggaaacatgtcggtacagatcggaaaccggtaacaaatacgaaaacgttaaactatagaaaacatatataagtatgttatatgtacaaataaattcaagctatactatataaattataaattaactccattttagccatgcactcaagttagggatttgattgaagaatcaatcaatctctaaactgtgggtcaagtagagacgtgccctttagatatcaacatatttagaaatacggtaattaccacattataagaaacggtaattttcataagaatacggtaaatatggaaacgatcggtacaacagcaaaatcatttccgtttccattttcatattttttaccatttccatatggctcggccggtagaaagtcggaaacgaacgctagtcggccgggaatttccgttaccgttttcacccctatatataagtaaataggatgcctgcatcctagtatcctacactttagcaccttcaattaattaattgttgcaggtaacttcttattaagatgaaaaataattattatctgcatgagacttagctgaatcaatattttcctagttaactcatatgtgccaaattccatttgtaatttcaccaaaaaacatgtgcggtataaaaatgtatagaagtattgaagtacttcaatattttttggggcatattcttgagtatagtactatagcatgtgaacatgcacgttctaatttctaaggttgaatcatatatactgcagcaagtcaaagatgatactttaggcttggccaagaaacttgaagctcttgatgagtccagacggtaagcaatcgtgtctctttctgaggagtatgattacatgataatcctgagagccaaaaaaaaaaatcagtagttcactctgaattacatgtgatgcaggaaaatattgggagaaaatttagaaggattctctattgaagaactgcgtggtctagaaatgaaacttgagaagagcctccacaagataagactaaagaaggtttatattagctattttcagtactcctaatggccatgagaaaattgaaggcaaactttttagaaactatgaataatcttctgtttacagaaattattaacacgcattcttctatattatctattcgttaacactagaccgagcttctggagcagcagatagccaagctgaaagagaaggtatacagccgcaatcaatgcatattcctattccctatagcaatacatcaaactccatatatttttttccctaactctggatgttatttttttccttgcatctctctgatattaggagcggactttgcttaaagacaacgaaaatttacgcggaaaggtaatcaatgattatgaacaaccgcctgttatcaggcaaaacaacatatactgcaaactacctttttcttcttttatccagtaaagctgcacgtacagagtatatctgatatctcatgcatgtgctgatgtgcagcctaattatattatccaaataaccagattgatatatgacccatcaaccacaccattatttacatgtgcaattgattcatttttacaacaaacttaggctgtgtgacttatggcagaatctgagatataaacaatttccattaattatcttgagaaaatgtgcaattgatctctgcagcatcgcaaccttgaggctgcggcgctggtggctaaccacatgacgacgacgacggcgccggcggcgtggccgcgggacgtgcctatgacgagcagcacagccggcgccgccgacgccatggacgtggagactgatctgtacattggattgcccggcactgagcgctcctccaaccggtcggagacaggttgaagaaggccagccacagcaacagctgctatatagcatgcagtagcagcaacgacgccagtgacatcctgttcatctcacaagaataaccagagctctacgcatgcgcacatgaaacccaggcatgcagttctcggtgggtaaattattatctcgcattattagctatatgcgtgtccttgtctttttctttaggcaatggaataaaatttccggtaagtacaaacacaaacggaaacaaagaattaacaaagctgtagcagaccagatcggcaaattgaaatgccaggtaatccagtatatatttcgcttcc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0536100, RefSeq:Os10g0536100