Difference between revisions of "Os01g0749300"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 +
[[File:OsHsfA4a Fig.01.png|right|thumb|200px|Fig.01 Identification of Amino Acid Residues in the DBD of Ta HsfA4a That Are Critical for Cd Tolerance]]
 +
[[File:OsHsfA4a Fig.02.png|right|thumb|200px|Fig.02 Enhanced Cd Resistance in Ta HsfA4a–Overexpressing Rice Plants]]
 +
[[File:OsHsfA4a Fig.03.png|right|thumb|200px|Fig.03 Plant Proteins with Homology to Ta HsfA4a]]
 
Os HsfA4a is a rice ortholog of Ta HsfA4a which plays a role as Cd tolerance gene of Wheat. Ta HsfA4a is the most similar to the class A4 Hsfs that confer Cd tolerance to a Cd hypersensitive yeast strain identified Heat shock transcription factor A4a(HsfA4a). Cd tolerance is enhanced in rice plants expressing Ta HsfA4a and decreased in rice plant with knocked-down expression of Os HsfA4a. The DNA binding domain (DBD) of HsfA4a is critical for Cd tolerance, and within the DBD, Ala-31 and Leu-42 are important for Cd tolerance. Os HsfA4a confers Cd tolerance in the root of rice by upregulating metallothionein(MT) gene expression in planta. HsfA4a is unique not only in the high level of tolerance that it confers, but also in its Cd specificity. Os HsfA4a greatly enhances Cd tolerance in rice, but does not significantly enhance their tolerance to the other heavy metals, namely, lead, zinc, cobalt, manganese, silver, mercury, and iron.
 
Os HsfA4a is a rice ortholog of Ta HsfA4a which plays a role as Cd tolerance gene of Wheat. Ta HsfA4a is the most similar to the class A4 Hsfs that confer Cd tolerance to a Cd hypersensitive yeast strain identified Heat shock transcription factor A4a(HsfA4a). Cd tolerance is enhanced in rice plants expressing Ta HsfA4a and decreased in rice plant with knocked-down expression of Os HsfA4a. The DNA binding domain (DBD) of HsfA4a is critical for Cd tolerance, and within the DBD, Ala-31 and Leu-42 are important for Cd tolerance. Os HsfA4a confers Cd tolerance in the root of rice by upregulating metallothionein(MT) gene expression in planta. HsfA4a is unique not only in the high level of tolerance that it confers, but also in its Cd specificity. Os HsfA4a greatly enhances Cd tolerance in rice, but does not significantly enhance their tolerance to the other heavy metals, namely, lead, zinc, cobalt, manganese, silver, mercury, and iron.
  

Revision as of 04:57, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Fig.01 Identification of Amino Acid Residues in the DBD of Ta HsfA4a That Are Critical for Cd Tolerance
Fig.02 Enhanced Cd Resistance in Ta HsfA4a–Overexpressing Rice Plants
Fig.03 Plant Proteins with Homology to Ta HsfA4a

Os HsfA4a is a rice ortholog of Ta HsfA4a which plays a role as Cd tolerance gene of Wheat. Ta HsfA4a is the most similar to the class A4 Hsfs that confer Cd tolerance to a Cd hypersensitive yeast strain identified Heat shock transcription factor A4a(HsfA4a). Cd tolerance is enhanced in rice plants expressing Ta HsfA4a and decreased in rice plant with knocked-down expression of Os HsfA4a. The DNA binding domain (DBD) of HsfA4a is critical for Cd tolerance, and within the DBD, Ala-31 and Leu-42 are important for Cd tolerance. Os HsfA4a confers Cd tolerance in the root of rice by upregulating metallothionein(MT) gene expression in planta. HsfA4a is unique not only in the high level of tolerance that it confers, but also in its Cd specificity. Os HsfA4a greatly enhances Cd tolerance in rice, but does not significantly enhance their tolerance to the other heavy metals, namely, lead, zinc, cobalt, manganese, silver, mercury, and iron.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0749300

Description

Similar to Heat shock factor

Version

NM_001050782.1 GI:115439934 GeneID:4325556

Length

2317 bp

Definition

Oryza sativa Japonica Group Os01g0749300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:33126259..33128575

Sequence Coding Region

33126439..33126651,33127234..33128343

Expression

GEO Profiles:Os01g0749300

Genome Context

<gbrowseImage1> name=NC_008394:33126259..33128575 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:33126259..33128575 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggggggcggcgggggcgggtcgctgccgccgttcctgagcaagacgtacgagatggtggacgacccgtcgacggacgcggtggtggggtggacgcccgccggcaccagcttcgtcgtcgccaaccagcccgagttctgccgggatctgctccccaagtacttcaagcacaacaacttctccagcttcgtgcgacagctcaacacctatggctttaggaaagtagatccagaacaatgggaatttgcaaatgaggatttcataaaaggacagcggcaccggttgaaaaatatacatagacgcaaacctatattcagccattcatcacacagtcagggtgctggaccattaacagataatgaaaggaaagactatgaggaagaaatcgagaggctcaaatccgataatgcagcactgtcctcagagcttcaaaataatacgttgaagaaacttaatatggagaaacgaatgcaggctttggaagagaagctatttgttgtggaagatcagcagaggagtctgatatcatacgtcagagagattgtaaaggcaccaggatttctttctagctttgtacagcaacaagatcatcacaggaagaagaggagactgccaataccaatctccttccatgaggatgcaaatactcaggagaaccagatcatgccttgtgacttgaccaactcaccagctcagacattttacagagaatcatttgacaagatggaatcatccttgaactcattagaaaatttccttcgagaagcaagtgaagaatttggtaatgatatttcatatgatgatggtgtcccaggcccttcttcaactgttgttctcacagagctccattcacctggtgaaagtgatccccgtgtttcatcacctccaacaaggatgcgtacttcgtcagctggtgcaggagattcgcactcctctcgtgatgtagcagagtctaccagctgtgcagaaagtcctcctattcctcaaatgcattctcgtgtagatacacgagcgaaggtttctgaaatagatgttaattcagaacctgctgttacagaaactggtccatcaagagatcaacctgctgaagagcctcctgctgtcacacctggtgcaaacgatggcttctggcagcagtttcttaccgagcagcctggatcatcagatgcacatcaggaggctcaatcagaacggcgagatggaggaaacaaggtggatgagatgaaatcaggagatcgacaacatctttggtggggcaaaaggaacgttgagcagataacagaaaaacttggacttctcacctcaacggagaaaacctga</cdnaseq>

Protein Sequence

<aaseq>MEGGGGGGSLPPFLSKTYEMVDDPSTDAVVGWTPAGTSFVVANQ PEFCRDLLPKYFKHNNFSSFVRQLNTYGFRKVDPEQWEFANEDFIKGQRHRLKNIHRR KPIFSHSSHSQGAGPLTDNERKDYEEEIERLKSDNAALSSELQNNTLKKLNMEKRMQA LEEKLFVVEDQQRSLISYVREIVKAPGFLSSFVQQQDHHRKKRRLPIPISFHEDANTQ ENQIMPCDLTNSPAQTFYRESFDKMESSLNSLENFLREASEEFGNDISYDDGVPGPSS TVVLTELHSPGESDPRVSSPPTRMRTSSAGAGDSHSSRDVAESTSCAESPPIPQMHSR VDTRAKVSEIDVNSEPAVTETGPSRDQPAEEPPAVTPGANDGFWQQFLTEQPGSSDAH QEAQSERRDGGNKVDEMKSGDRQHLWWGKRNVEQITEKLGLLTSTEKT</aaseq>

Gene Sequence

<dnaseqindica>181..393#976..2085#aatccgagagggatttttcctcgcaaccaaccaaaccaaccaaacccccaaccaagcgagcaagccgccttcgccgggggggcccccaccctgacggcaaccctagccctccgatcaccggcgctgagactgatcccgccgccgtaggaggaggaggaggaggtggtggtggtggtggtgatggaggggggcggcgggggcgggtcgctgccgccgttcctgagcaagacgtacgagatggtggacgacccgtcgacggacgcggtggtggggtggacgcccgccggcaccagcttcgtcgtcgccaaccagcccgagttctgccgggatctgctccccaagtacttcaagcacaacaacttctccagcttcgtgcgacagctcaacacctatgtaagggagctcgcctcttaacctcatgtgtgcctttctgtcttcctctgctctgccgctgatgcttgaattggggcttggtcgtaatgcgcgcccgccgggacctatgggctgggtaggaatgccggatttgttagaattgggcgagtcctttgctgtaattactcctgtttaggatttattactttcagcacaaaatattttataagttttcgttgattgctagtatagcatattctgttcattttaggattttaagacagtacttgtgaataaccaaggtcaactcttgttctaccaagaaaattcaagtagcttattgcaatgttattgtcttctccatccggttgaagttgtacaaaaatgtttgataatggtgagtgaggttgaaatagatgtgtgttcacatcaatgtcaaagctccaaactgttttagaattgaagcaagctatccggtacagttcattccttgtggtggcagtgcatagttttttttagccttgatcatgtatgattttttttccccttttggctgcttgagttatgctattttaatgaggatccccttttgttctcatttagggctttaggaaagtagatccagaacaatgggaatttgcaaatgaggatttcataaaaggacagcggcaccggttgaaaaatatacatagacgcaaacctatattcagccattcatcacacagtcagggtgctggaccattaacagataatgaaaggaaagactatgaggaagaaatcgagaggctcaaatccgataatgcagcactgtcctcagagcttcaaaataatacgttgaagaaacttaatatggagaaacgaatgcaggctttggaagagaagctatttgttgtggaagatcagcagaggagtctgatatcatacgtcagagagattgtaaaggcaccaggatttctttctagctttgtacagcaacaagatcatcacaggaagaagaggagactgccaataccaatctccttccatgaggatgcaaatactcaggagaaccagatcatgccttgtgacttgaccaactcaccagctcagacattttacagagaatcatttgacaagatggaatcatccttgaactcattagaaaatttccttcgagaagcaagtgaagaatttggtaatgatatttcatatgatgatggtgtcccaggcccttcttcaactgttgttctcacagagctccattcacctggtgaaagtgatccccgtgtttcatcacctccaacaaggatgcgtacttcgtcagctggtgcaggagattcgcactcctctcgtgatgtagcagagtctaccagctgtgcagaaagtcctcctattcctcaaatgcattctcgtgtagatacacgagcgaaggtttctgaaatagatgttaattcagaacctgctgttacagaaactggtccatcaagagatcaacctgctgaagagcctcctgctgtcacacctggtgcaaacgatggcttctggcagcagtttcttaccgagcagcctggatcatcagatgcacatcaggaggctcaatcagaacggcgagatggaggaaacaaggtggatgagatgaaatcaggagatcgacaacatctttggtggggcaaaaggaacgttgagcagataacagaaaaacttggacttctcacctcaacggagaaaacctgacataattttgtttttctttttgtagatgaaaaactattaattcaggaacgctgacattggtgccttcctcagtgagatatgttgactaacatctatttcgcagtgtaccgtattttttccatcatgtaccgtaatgtatcatagtgccatacattcatctttggtccattgacactttctgatatcattgtgcgtgatttctaaaatattctcaagtttggttaaatgttac</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0749300, RefSeq:Os01g0749300