Difference between revisions of "Os09g0522200"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
Line 9: Line 9:
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
The analyses of the similarities of the ERF/AP2 domains of the ''OsDREB'' proteins and compared them with those in Arabidopsis and other genera. The ''OsDREB1'' proteins were classified into the A-1 (DREB1/CBF) subgroup which is one of five groups of ERF/AP2-related proteins– AP2 subfamily,RAV subfamily, DREB subfamily, ERF subfamily, and one very specific gene, AL079349. The DREB1-type ERF/AP2 domains in the three monocots were closely related to each other but distant from those in the dicots.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 05:04, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Os09g0522200(OsDREB1A) is one of the five OsDREB genes( OsDREB1A, OsDREB1B, OsDREB1C, OsDREB1D, and OsDREB2A) in rice, Oryza sativa L. isolated by Dubouzet et al for DREB homologs. The transcription factors DREBs/CBFs specifically interact with the dehydration-responsive element/Crepeat (DRE/CRT) cis-acting element (core motif: G/ACCGAC) and control the expression of many stress-inducible genes in Arabidopsis. To compare the function of OsDREB1A with that of DREB1A, we generated transgenic plants in which the OsDREB1A cDNA was over-expressed (35S:OsDREB1A).The tolerance to freezing and high-salt stresses of the 35S:OsDREB1A plants was compared with those of the wild-type and 35S:DREB1Ac plants which had the lowest level of stress tolerance among the 35S:DREB1A transgenic Arabidopsis plants.Over-expression of OsDREB1A in transgenic Arabidopsis induced overexpression of target stress-inducible genes of Arabidopsis DREB1A resulting in plants with higher tolerance to drought, high-salt, and freezing stresses. This indicated that OsDREB1A has functional similarity to DREB1A. However, in microarray and RNA blot analyses, some stress-inducible target genes of the DREB1A proteins that have only ACCGAC as DRE were not over-expressed in the OsDREB1A transgenic Arabidopsis. The OsDREB1A protein bound to GCCGAC more preferentially than to ACCGAC whereas the DREB1A proteins bound to both GCCGAC and ACCGAC efficiently. OsDREB1A is potentially useful for producing transgenic monocots that are tolerant to drought, high-salt, and/or cold stresses.

Expression

The expression patterns of the OsDREB genes were analyzed by RNA-gel blot hybridization. The OsDREB1A genes were not responsive to exposure to ABA but they were induced within 40 min after exposure to cold stress. OsDREB1A was also induced within 5 h after salt treatment and was transiently expressed in wounded seedlings.

Evolution

The analyses of the similarities of the ERF/AP2 domains of the OsDREB proteins and compared them with those in Arabidopsis and other genera. The OsDREB1 proteins were classified into the A-1 (DREB1/CBF) subgroup which is one of five groups of ERF/AP2-related proteins– AP2 subfamily,RAV subfamily, DREB subfamily, ERF subfamily, and one very specific gene, AL079349. The DREB1-type ERF/AP2 domains in the three monocots were closely related to each other but distant from those in the dicots.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0522200

Description

DRE-binding protein 1A

Version

NM_001070247.1 GI:115480236 GeneID:4347620

Length

920 bp

Definition

Oryza sativa Japonica Group Os09g0522200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:21146055..21146974

Sequence Coding Region

21146179..21146895

Expression

GEO Profiles:Os09g0522200

Genome Context

<gbrowseImage1> name=NC_008402:21146055..21146974 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:21146055..21146974 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgcgggatcaagcaggagatgagcggcgagtcgtcggggtcgccgtgcagctcggcgtcggcggagcggcagcaccagacggtgtggacggcgccgccgaagaggccggcggggcggaccaagttcagggagacgaggcacccggtgttccgcggcgtgcggcggaggggcaatgccgggaggtgggtgtgcgaggtgcgggtgcccgggcggcgcggctgcaggctctggctcggcacgttcgacaccgccgagggcgcggcgcgcgcgcacgacgccgccatgctcgccatcaacgccggcggcggcggcggcgggggagcatgctgcctcaacttcgccgactccgcgtggctcctcgccgtgccgcgctcctaccgcaccctcgccgacgtccgccacgccgtcgccgaggccgtcgaggacttcttccggcgccgcctcgccgacgacgcgctgtccgccacgtcgtcgtcctcgacgacgccgtccaccccacgcaccgacgacgacgaggagtccgccgccaccgacggcgacgagtcctcctccccggccagcgacctggcgttcgaactggacgtcctgagtgacatgggctgggacctgtactacgcgagcttggcgcaggggatgctcatggagccaccatcggcggcgctcggcgacgacggtgacgccatcctcgccgacgtcccactctggagctactag</cdnaseq>

Protein Sequence

<aaseq>MCGIKQEMSGESSGSPCSSASAERQHQTVWTAPPKRPAGRTKFR ETRHPVFRGVRRRGNAGRWVCEVRVPGRRGCRLWLGTFDTAEGAARAHDAAMLAINAG GGGGGGACCLNFADSAWLLAVPRSYRTLADVRHAVAEAVEDFFRRRLADDALSATSSS STTPSTPRTDDDEESAATDGDESSSPASDLAFELDVLSDMGWDLYYASLAQGMLMEPP SAALGDDGDAILADVPLWSY</aaseq>

Gene Sequence

<dnaseqindica>80..796#atcgccattaccacactcgagcagagcaaatacagttcaggaatcaggagcaagcagaaacacacacacaaatccgaagatgtgcgggatcaagcaggagatgagcggcgagtcgtcggggtcgccgtgcagctcggcgtcggcggagcggcagcaccagacggtgtggacggcgccgccgaagaggccggcggggcggaccaagttcagggagacgaggcacccggtgttccgcggcgtgcggcggaggggcaatgccgggaggtgggtgtgcgaggtgcgggtgcccgggcggcgcggctgcaggctctggctcggcacgttcgacaccgccgagggcgcggcgcgcgcgcacgacgccgccatgctcgccatcaacgccggcggcggcggcggcgggggagcatgctgcctcaacttcgccgactccgcgtggctcctcgccgtgccgcgctcctaccgcaccctcgccgacgtccgccacgccgtcgccgaggccgtcgaggacttcttccggcgccgcctcgccgacgacgcgctgtccgccacgtcgtcgtcctcgacgacgccgtccaccccacgcaccgacgacgacgaggagtccgccgccaccgacggcgacgagtcctcctccccggccagcgacctggcgttcgaactggacgtcctgagtgacatgggctgggacctgtactacgcgagcttggcgcaggggatgctcatggagccaccatcggcggcgctcggcgacgacggtgacgccatcctcgccgacgtcccactctggagctactagagctcaatcaactgtacaattttgcctcttttttctctcttttctggcttccgatgccaaaattttggtactgtacggacactactttcggtaatgtgatggaacaagttgcaaaacacagagc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0522200, RefSeq:Os09g0522200