Difference between revisions of "Os02g0624300"
(→Function) |
|||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
| − | + | The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved MYB DNA-binding domain, which generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats in the binding domain, plant MYB proteins are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000). e functions of MYB proteins in plants are very diverse. Some plant MYB genes are involved in the regulation of secondary metabolism, cellular morphogenesis, and cell cycle (Ma et al. 2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and drought (Martin and Paz 1997; Dai et al. 2007). | |
| − | + | Given the size of the gene family and their roles in plant speci c processes, the MYB family is considered to be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire 2002).In Arizona ash, few MYB genes have been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear. | |
===Expression=== | ===Expression=== | ||
Revision as of 06:30, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved MYB DNA-binding domain, which generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats in the binding domain, plant MYB proteins are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000). e functions of MYB proteins in plants are very diverse. Some plant MYB genes are involved in the regulation of secondary metabolism, cellular morphogenesis, and cell cycle (Ma et al. 2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and drought (Martin and Paz 1997; Dai et al. 2007). Given the size of the gene family and their roles in plant speci c processes, the MYB family is considered to be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire 2002).In Arizona ash, few MYB genes have been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0624300 |
|---|---|
| Description |
Similar to Y19 protein |
| Version |
NM_001054009.1 GI:115447388 GeneID:4330027 |
| Length |
1156 bp |
| Definition |
Oryza sativa Japonica Group Os02g0624300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:25765638..25766793 |
| Sequence Coding Region |
25765777..25766290,25766409..25766671 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:25765638..25766793 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:25765638..25766793 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccgatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaa</cdnaseq> |
| Protein Sequence |
<aaseq>MGRAPCCEKMGLKRGPWTAEEDRILVAHIERHGHSNWRALPRQA GLLRCGKSCRLRWINYLRPDIKRGNFTREEEDAIIHLHDLLGNRWSAIAARLPGRTDN EIKNVWHTHLKKRLEPKPSSGREAAAPKRKATKKAAAVAVAIDVPTTVPVSPEQSLST TTTSAATTEEYSYSMASSADHNTTDSFTSEEEFQIDDSFWSETLAMTVDSTDSGMEMS GGDPLGAGGASPSSSNDDDMDDFWLKLFIQAGGMQNLPQI</aaseq> |
| Gene Sequence |
<dnaseqindica>504..1017#123..385#gcatcacacagacgacgcagcatcagcaacacacacacacaccgagcaatcaatccatcacacacaaacacaaacaaacgcacagggcgcgagagctcgaacgagaggaggaaaggtcggcaatggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccggtacttttcaagccactgtccaatactagtttactaatcttttgccttggatacgcgaaagattttgtctcggatttgtttattggttaattaactcgatttgtggcgaatgattcagatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaatttaggcagagaattggcctcttgggtcgatctcttgttcatttttcttaccaccactattctttgaatctttggagctgtgtaaatctttacaaagcggagagattgatgggaaacgaaagaaggcaatattatcttt</dnaseqindica> |
| External Link(s) |
