Os02g0624300

Please input one-sentence summary here.

Annotated Information

The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved MYB DNA-binding domain, which generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats in the binding domain, plant MYB proteins are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000). e functions of MYB proteins in plants are very diverse. Some plant MYB genes are involved in the regulation of secondary metabolism, cellular morphogenesis, and cell cycle (Ma et al. 2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and drought (Martin and Paz 1997; Dai et al. 2007). Given the size of the gene family and their roles in plant speci c processes, the MYB family is considered to be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire 2002).In Arizona ash, few MYB genes have been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear.

Expression

The 4-week-old seedlings were transferred into Hoagland's solution with salt (300 mM) for 24 h. e seedlings grown on Hoagland’s solution were used as control.The roots, stems, cotyledons, and leaves were harvested separately and total RNA was reverse transcribed. e synthesized cDNA was used as template in semiquantitative RT-PCR and real-time PCR. For semiquantitative RT-PCR, the resulting cDNA was used as a template for 25 cycles of 30 s at 94 °C, 30 s at 58 °C, 30 s at 72 °C, and a nal extension at 72 °C for 10 min. Ten microliters of the PCR product were electrophoresed and visualized by ethidium bromide staining. Actin was used as a loading control. Primers used in semiquantitative RT-PCR were as follows: forward primer 5′-AGGGTTCATGCTGTTTGG-3′ and reverse primer 5′-GCTATTGTTGTTG GGTGGT-3′. Normalization was carried out by ampli cation of actin mRNA using a forward primer AF: 5′-TCCTCTTCCAGCCTTCTTT-3′ and a reverse primer AR: 5′-TTCCTT GCTCATACGGTCA-3′.Real-time PCR was also conducted using a BIORAD IQ5 (BioRad, USA) qPCR machine and the Maxima SYBR Green qPCR Master Mix (Fermentas) with primers Q-M1F (5′-TGTCGGGTTTCCAGACAATGCAA-3′) and Q-M1R (5′-TTTTCCCCCAACTTTCCAACACA-3′) for FvMYB1. Actin gene was used as housekeeping gene to normalize the target gene quantities.The same primers AF and AR were used for ampli cation of actin gene.The PCR annealing temperature of all primers was 60 °C.The expression level of the FvMYB1 gene was evaluated with respect to actin, which was constitutively expressed.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name	Os02g0624300
Description	Similar to Y19 protein
Version	NM_001054009.1 GI:115447388 GeneID:4330027
Length	1156 bp
Definition	Oryza sativa Japonica Group Os02g0624300, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 2
Location	Chromosome 2:25765638..25766793
Sequence Coding Region	25765777..25766290,25766409..25766671
Expression	GEO Profiles:Os02g0624300
Genome Context	<gbrowseImage1> name=NC_008395:25765638..25766793 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008395:25765638..25766793 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccgatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaa</cdnaseq>
Protein Sequence	<aaseq>MGRAPCCEKMGLKRGPWTAEEDRILVAHIERHGHSNWRALPRQA GLLRCGKSCRLRWINYLRPDIKRGNFTREEEDAIIHLHDLLGNRWSAIAARLPGRTDN EIKNVWHTHLKKRLEPKPSSGREAAAPKRKATKKAAAVAVAIDVPTTVPVSPEQSLST TTTSAATTEEYSYSMASSADHNTTDSFTSEEEFQIDDSFWSETLAMTVDSTDSGMEMS GGDPLGAGGASPSSSNDDDMDDFWLKLFIQAGGMQNLPQI</aaseq>
Gene Sequence	<dnaseqindica>504..1017#123..385#gcatcacacagacgacgcagcatcagcaacacacacacacaccgagcaatcaatccatcacacacaaacacaaacaaacgcacagggcgcgagagctcgaacgagaggaggaaaggtcggcaatggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccggtacttttcaagccactgtccaatactagtttactaatcttttgccttggatacgcgaaagattttgtctcggatttgtttattggttaattaactcgatttgtggcgaatgattcagatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaatttaggcagagaattggcctcttgggtcgatctcttgttcatttttcttaccaccactattctttgaatctttggagctgtgtaaatctttacaaagcggagagattgatgggaaacgaaagaaggcaatattatcttt</dnaseqindica>
External Link(s)	NCBI Gene:Os02g0624300, RefSeq:Os02g0624300