Difference between revisions of "Os09g0459200"

From RiceWiki
Jump to: navigation, search
(Expression)
(Labs working on this gene)
Line 23: Line 23:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
 
 
National Institute of Agrobiological Sciences
 
National Institute of Agrobiological Sciences
 
Graduate School of Science and Technology
 
Graduate School of Science and Technology
 
Tokyo University of Science  
 
Tokyo University of Science  
 
RIKEN Advanced Science Institute
 
RIKEN Advanced Science Institute
 +
 
==References==
 
==References==
  

Revision as of 07:07, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches. Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent of brassinosteroid (BR)-deficient mutants, with wide, dark-green, and erect leaves.SG1 decreases organ elongation by decreasing cell proliferation. SG1 decreases responses to BRs and elongation of organs such as seeds and the internodes of rachis branches through decreased cellular proliferation[1].

Expression

During vegetative growth,SG1 was preferentially expressed in the roots. During reproductive growth, SG1 was strongly expressed in the young panicles (0.3–1 cm in length), and expression then gradually decreased as the panicles matured. In the developing panicles, SG1 was expressed most strongly in the spikelets and the basal parts of rachis and rachis branches. SG1 encodes a novel protein that is conserved among angiosperms.SG1 does not share significant identity with any proteins of known function. However, SG1 and related proteins comprise a family that is conserved among monocots and dicots The rice genome encodes two SG1-related proteins (Os02g0762600 and Os08g0474100) that have 49% to 53% sequence identity with SG1.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

National Institute of Agrobiological Sciences Graduate School of Science and Technology Tokyo University of Science RIKEN Advanced Science Institute

References

[1]Hitoshi Nakagawa, Atsunori Tanaka, Takanari Tanabata, Miki Ohtake, Shozo Fujioka, et al. short GRAIN1 decreases organ elongation and brassinosteroid response in rice.Plant Physiol 2012 158:1208-19.

Structured Information

Gene Name

Os09g0459200

Description

Conserved hypothetical protein

Version

NM_001069915.1 GI:115479572 GeneID:4347276

Length

1474 bp

Definition

Oryza sativa Japonica Group Os09g0459200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:18004651..18006124

Sequence Coding Region

18004776..18005216,18005552..18005584

Expression

GEO Profiles:Os09g0459200

Genome Context

<gbrowseImage1> name=NC_008402:18004651..18006124 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:18004651..18006124 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggatcttggaggtcaagggagcacgagagactga</cdnaseq>

Protein Sequence

<aaseq>MACVNMYNPEHHHHQSSSFMAPRISFSSDFALEPPPPAQQQPAV RAPGDADFEFSVGSHPMMAADQLISKGRLLPLREAPHGHGGADAGGRPLTLRDELRTD SRHGRVPRAPNIRWKEFLGLKKAPKKAPTADAAAGATSSSADTQMDLGGQGSTRD</aaseq>

Gene Sequence

<dnaseqindica>126..566#902..934#attctccatagcttggccaccgtagtaaagccggcgagctaattctagttctagccagctacacgagatcatcgctgtgacgggcggggcattgagagggcgcgtgtgccggccggggtcgatgcatggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggtaataacaagctcactgtttcttgcgccatgaatgcactctgctacagctctgcattgtcccattttgcttgtcgcattgcaacatttttcgaatcttcaaaaacaccctgcttgctgcaagaccctcctgcgcagtagagtacaagcactttctgcttcaaagatttctcaaagtttggagcctgagatagatgtgcattgcatgcatgtactactcatgcattgctaaccaccagaaccagattgcacagaaattttagcggcacaactactcatgcattgttaaccattttcctgctgaagtgacaacaaaatgtatgcaaaaccctgtaggatcttggaggtcaagggagcacgagagactgaagcaacaaacgcaatgaagtgtattactgatcaatgagtactacgtagtagtgaaactgaagtagccatggttggccagatcggatgcatggtggcgatgcgcctttcagcttgctgtctgccatcactcatattcactcttgctgatgatcttagcagctcattctaatggagaactctgcagggcaaatggccatttccttttacctctttgctgcatcttttttgggtgtaaaagggaattttgatctctagtttttgggtaatggtcgtcgtcgggtagatgggtggttccagtgtagtcaaattaactccgctgcgcctctgatgttttgtattggaagggccagtaaaaatgtatttttccccacatggtgtggtcctagcttagcttttgtacgtgttgtttagctgttcccatgcttgtctgcttccgccacctccgctctctcccccactttccctatgtacaaaaatgcttgtaatctagtagtagctagcaattcaagctttcagttcaatgaagcccatttcaacgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0459200, RefSeq:Os09g0459200

  1. Hitoshi Nakagawa, Atsunori Tanaka, Takanari Tanabata, Miki Ohtake, Shozo Fujioka, et al. short GRAIN1 decreases organ elongation and brassinosteroid response in rice.Plant Physiol 2012 158:1208-19.