Difference between revisions of "Os09g0459200"
Yanyangtian (talk | contribs) (→Function) |
Yanyangtian (talk | contribs) (→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| + | [[File:identification.png|right|thumb|150px|"Figure 1. Identification of the rice SG1 gene by activation tagging. A to C, Phenotypes of the Sg1-Dricemutant. A,Heading stage: In | ||
| + | comparison with the wild-type plants (WT), the Sg1-D homozygote showed a semidwarf phenotype. B, The short-grain phenotype | ||
| + | cosegregatedwith the T-DNA insertion in a dose-dependent manner. Seeds ofWT (+/+), Sg1-D heterozygotes (Sg1-D/+), and Sg1-D | ||
| + | homozygotes (Sg1-D homo) are shown. Means and SD from at least 30 measurements of lengths (L, mm), widths (W, mm), and the | ||
| + | ratio of length towidth (L/W) are shown below the seeds. C, Leaf blades of the Sg1-D homozygote were dark green and were shorter | ||
| + | and wider than those of wild type. Means and SD from at least nine measurements of lengths (L, cm) and widths (W, cm) of second | ||
| + | uppermost leaves are shown. D, Schematic representation of the T-DNA flanking region of the Sg1-D mutant. A candidate for the | ||
| + | ORF responsible for the phenotype (Os09g0459200, which encodes a novel protein with unknown function, colored blue), referred | ||
| + | to as SG1, is located 1.4-kb downstream of the T-DNA insertion. The cauliflower mosaic virus 35S minimal promoter (P35S) and a | ||
| + | tetramer of the 35S enhancer (43EN) are shown by the black triangles and the green box, respectively. LB and RB are left and right | ||
| + | borders of the T-DNA. Pnos, Nopaline synthase promoter sequence; PAT, ORF-containing region of the phosphinothricin | ||
| + | acetyltransferase gene. E, The levels of SG1 mRNA in the WT, Sg1-D heterozygote, and Sg1-D homozygote plants. For each | ||
| + | genotype, RNA from two independent plants was used for qPCR, and values were normalized using RUBQ2 as a standard. F, The | ||
| + | Sg1-D mutant shows reduced panicle internode elongation in a dose-dependent manner. Bases of the terminal spikelets and nodes | ||
| + | of the primary rachis branches are connectedwith dotted lines. Asterisks show that significantly different fromWT. **, P,0.01; ***, | ||
| + | P , 0.001 (Student’s t test)(from reference<ref name="ref1"/>）." ]] | ||
SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches. | SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches. | ||
Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent | Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent | ||
Revision as of 08:01, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches. Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent of brassinosteroid (BR)-deficient mutants, with wide, dark-green, and erect leaves.SG1 decreases organ elongation by decreasing cell proliferation and also decreases responses to BRs and elongation of organs such as seeds and the internodes of rachis branches through decreased cellular proliferation[1]
Expression
During vegetative growth,SG1 was preferentially expressed in the roots. During reproductive growth, SG1 was strongly expressed in the young panicles (0.3–1 cm in length), and expression then gradually decreased as the panicles matured. In the developing panicles, SG1 was expressed most strongly in the spikelets and the basal parts of rachis and rachis branches. SG1 encodes a novel protein that is conserved among angiosperms.SG1 does not share significant identity with any proteins of known function. However, SG1 and related proteins comprise a family that is conserved among monocots and dicots. The rice genome encodes two SG1-related proteins (Os02g0762600 and Os08g0474100) that have 49% to 53% sequence identity with SG1.[1]
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- National Institute of Agrobiological Sciences
- Graduate School of Science and Technology
- Tokyo University of Science
- RIKEN Advanced Science Institute
References
Structured Information
| Gene Name |
Os09g0459200 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001069915.1 GI:115479572 GeneID:4347276 |
| Length |
1474 bp |
| Definition |
Oryza sativa Japonica Group Os09g0459200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:18004651..18006124 |
| Sequence Coding Region |
18004776..18005216,18005552..18005584 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:18004651..18006124 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:18004651..18006124 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggatcttggaggtcaagggagcacgagagactga</cdnaseq> |
| Protein Sequence |
<aaseq>MACVNMYNPEHHHHQSSSFMAPRISFSSDFALEPPPPAQQQPAV RAPGDADFEFSVGSHPMMAADQLISKGRLLPLREAPHGHGGADAGGRPLTLRDELRTD SRHGRVPRAPNIRWKEFLGLKKAPKKAPTADAAAGATSSSADTQMDLGGQGSTRD</aaseq> |
| Gene Sequence |
<dnaseqindica>126..566#902..934#attctccatagcttggccaccgtagtaaagccggcgagctaattctagttctagccagctacacgagatcatcgctgtgacgggcggggcattgagagggcgcgtgtgccggccggggtcgatgcatggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggtaataacaagctcactgtttcttgcgccatgaatgcactctgctacagctctgcattgtcccattttgcttgtcgcattgcaacatttttcgaatcttcaaaaacaccctgcttgctgcaagaccctcctgcgcagtagagtacaagcactttctgcttcaaagatttctcaaagtttggagcctgagatagatgtgcattgcatgcatgtactactcatgcattgctaaccaccagaaccagattgcacagaaattttagcggcacaactactcatgcattgttaaccattttcctgctgaagtgacaacaaaatgtatgcaaaaccctgtaggatcttggaggtcaagggagcacgagagactgaagcaacaaacgcaatgaagtgtattactgatcaatgagtactacgtagtagtgaaactgaagtagccatggttggccagatcggatgcatggtggcgatgcgcctttcagcttgctgtctgccatcactcatattcactcttgctgatgatcttagcagctcattctaatggagaactctgcagggcaaatggccatttccttttacctctttgctgcatcttttttgggtgtaaaagggaattttgatctctagtttttgggtaatggtcgtcgtcgggtagatgggtggttccagtgtagtcaaattaactccgctgcgcctctgatgttttgtattggaagggccagtaaaaatgtatttttccccacatggtgtggtcctagcttagcttttgtacgtgttgtttagctgttcccatgcttgtctgcttccgccacctccgctctctcccccactttccctatgtacaaaaatgcttgtaatctagtagtagctagcaattcaagctttcagttcaatgaagcccatttcaacgtt</dnaseqindica> |
| External Link(s) |
