Difference between revisions of "Os09g0470500"
Littlescrew (talk | contribs) (→Function) |
Littlescrew (talk | contribs) (→Expression) |
||
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | Oshox4 expresses in leaf primordial of shoot apex, and in young leaves without polar distribution (Fig. 2A, a,b), even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA (Fig. 2A, c–e). Oshox4 expresses more in drought resistant than in drought-sensitive rice cultivars | + | ''Oshox4'' expresses in leaf primordial of shoot apex, and in young leaves without polar distribution (Fig. 2A, a,b), even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA (Fig. 2A, c–e). ''Oshox4'' expresses more in drought resistant than in drought-sensitive rice cultivars <ref name="ref1" />. |
| − | To understand the subcellular localization of Oshox4, researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells | + | To understand the subcellular localization of ''Oshox4'', researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells <ref name="ref4" />(Fig. 2B). |
===Evolution=== | ===Evolution=== | ||
Revision as of 08:36, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Oshox4 belongs to the homeodomain leucine zipper (HD-Zip) genes that encode transcription factors that contain conserved DNA motif called the homeobox[1]. There are four family members in HD-Zip including I, I, II, III and IV [2], and Oshox4 which locates in chromosome 9 belongs to HD-Zip I. In addition, it is suggested that all HD-Zip I and II proteins family members can form homodimers and also heterodimers[3].
Expression
Oshox4 expresses in leaf primordial of shoot apex, and in young leaves without polar distribution (Fig. 2A, a,b), even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA (Fig. 2A, c–e). Oshox4 expresses more in drought resistant than in drought-sensitive rice cultivars [1]. To understand the subcellular localization of Oshox4, researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells [4](Fig. 2B).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os09g0470500 |
|---|---|
| Description |
Homeodomain leucine zipper protein |
| Version |
NM_001069971.1 GI:115479684 GeneID:4347333 |
| Length |
1716 bp |
| Definition |
Oryza sativa Japonica Group Os09g0470500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:18556879..18558594 |
| Sequence Coding Region |
18557207..18557276,18557394..18557740,18557867..18558283 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:18556879..18558594 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:18556879..18558594 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtgatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactga</cdnaseq> |
| Protein Sequence |
<aaseq>MKRPGGAGGGGGSPSLVTMANSSDDGYGGVGMEAEGDVEEEMMA CGGGGEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRAR WKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVK EEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAPAATDALAPEACTFLGAPPAAGAG AGAAAAASHEEVFFHGNFLKVEEDETGFLDDDEPCGGFFADDQPPPLSSWWAEPTEHW N</aaseq> |
| Gene Sequence |
<dnaseqindica>329..398#516..862#989..1405#gaaaacagaaaggaaaccgagaaagagagagagagagagagaggtagggagggaagaagagtcactccacactccacactctcatcccctggtccctttcttggatcatgagaaaccgcgcaacaaaattgcaattctaggcagcatttggaccggggacttggctacgtggtgtttggccatggatcgcagcgtggaattaagaccggcgaggactcagcgacggaggcacccgcgtcattcctacgcttctgtgcccgtcgtcttctcgcagtgagagagagagagagatcgaccaggcgttcactgaattttactagaactcggcatgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtggtaatctttgttctttggttttccttttgtggcaattcattctttggaggtgatggtgtagtgtgatatgtgcgggaaattgagtgttttgtaattgtacatgcgtgttttgattagatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgaggtacgtgccgactgagtcgctgccctgccgtgccgcctgagctgttgctctgcgtgactgcgtcgagcagtcgttcgtttgcgcgcataatgtctgatggcttcttggtcgcgcgaattgtggcagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactgaagcaaatccggcgtaaccgcagccgagagagagagttggaaaacactatgcctgggggaataaagaattctgcaggaaagcagggtcttatctgcaattttgtaaaaaaaatggacctctacgtacttctctagtctcttttgccaattctcgcgcacattagctgtagcactgcagtgtagtaaaatcctactactccattacctctccaatttctagctctcacttccctacttaaactcatctgagctctaatgtaagcatatgccatccaaaatggaccataaatatgtcactagcagtaggatggt</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4
