Difference between revisions of "Os01g0826400"
(→Annotated Information) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsWRKY24, which encodes aprotein that functions as a negative regulator of both GA andABA signaling. Abscisic acid (ABA) and gibberellins (GAs) control several developmental processes including seed maturation, dormancy, and germination. The antagonism of these two hormones is well-documented. The transcription profiling studies indicate that they can function as agonists in regulating the expression of many genes. A rice WRKY gene,OsWRKY24, which encodes a protein that functions as a negative regulator of both GA and ABA signaling. Overexpression of OsWRKY24 via particle bombardment-mediated transient expression in aleurone cells represses the expression of two reporter constructs: the β-glucuronidase gene driven by the GA-inducible Amy32b α-amylase promoter (Amy32b-GUS) and the ABA-inducible HVA22 promoter (HVA22-GUS). OsWRKY24 is unlikely a general repressor because it has little effect on the expression of the luciferase reporter gene driven by a constitutive ubiquitin promoter (UBI-Luciferase)[1]. | |
===Expression=== | ===Expression=== | ||
| − | + | Rice WRKY genes that are involved in modulating GA and/or ABA responses in aleurone cells. WRKY proteins possess at leastone WRKY domain, which is about 60 amino acids in lengthand contains a WRKY motif and a putative zinc-finger motif[2]. A large number of the WRKY genes have been shown to be involved in plant defense responses[3].about one hundred WRKY gene have been found in the rice genome[4].The steady state mRNA levels of several rice WRKY genes are affected by ABA and GA. For example, ABA enhances, while GA decreases the mRNA levels of OsWRKY51 and OsWRKY71[5].As to the functions,OsWRKY51 and OsWRKY71 suppress GA induction of the a-amylase gene promoter; yet they have little effect on ABA induction of the HVA22 promoter (class I)[6].Another class of OsWRKY genes, | |
| + | such as OsWRKY72and OsWRKY77, function as activators of ABA signaling (class II)[7].While OsWRKY24, which negatively regulates both GA and ABA signaling in aleurone cells. It represents the third class of OsWRKY genes that are different from class I and II in regulating GA and ABA signaling pathways[1]. | ||
| + | |||
| + | 1.Like in aleurone cells, the expression of OsWRKY24 in rice embryos is not affected by GA, but slightly induced by ABA at some stages of the treatment | ||
| + | the OsWRKY24 was expressed at a relatively high level in the aleurone cells purified from dry seeds[5].When the embryoless half-seeds were treated with the buffer only or GA3 for 4, 24, or 24 h, the OsWRKY24mRNA level changed little in the aleurone cells. The ABA treatment did not affect theOsWRKY24mRNA much either at the 4 h time point, but slightly enhanced its expression at the 24 and 48 h time points. A similar pattern was observed for the samples treated with a combination of ABA and GA3[1]. | ||
| + | 2.OsWRKY24 represses GA induction of the low pI α-amylase Amy32b promoter | ||
| + | |||
| + | |||
| + | |||
| + | |||
| + | |||
===Evolution=== | ===Evolution=== | ||
Revision as of 08:39, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsWRKY24, which encodes aprotein that functions as a negative regulator of both GA andABA signaling. Abscisic acid (ABA) and gibberellins (GAs) control several developmental processes including seed maturation, dormancy, and germination. The antagonism of these two hormones is well-documented. The transcription profiling studies indicate that they can function as agonists in regulating the expression of many genes. A rice WRKY gene,OsWRKY24, which encodes a protein that functions as a negative regulator of both GA and ABA signaling. Overexpression of OsWRKY24 via particle bombardment-mediated transient expression in aleurone cells represses the expression of two reporter constructs: the β-glucuronidase gene driven by the GA-inducible Amy32b α-amylase promoter (Amy32b-GUS) and the ABA-inducible HVA22 promoter (HVA22-GUS). OsWRKY24 is unlikely a general repressor because it has little effect on the expression of the luciferase reporter gene driven by a constitutive ubiquitin promoter (UBI-Luciferase)[1].
Expression
Rice WRKY genes that are involved in modulating GA and/or ABA responses in aleurone cells. WRKY proteins possess at leastone WRKY domain, which is about 60 amino acids in lengthand contains a WRKY motif and a putative zinc-finger motif[2]. A large number of the WRKY genes have been shown to be involved in plant defense responses[3].about one hundred WRKY gene have been found in the rice genome[4].The steady state mRNA levels of several rice WRKY genes are affected by ABA and GA. For example, ABA enhances, while GA decreases the mRNA levels of OsWRKY51 and OsWRKY71[5].As to the functions,OsWRKY51 and OsWRKY71 suppress GA induction of the a-amylase gene promoter; yet they have little effect on ABA induction of the HVA22 promoter (class I)[6].Another class of OsWRKY genes, such as OsWRKY72and OsWRKY77, function as activators of ABA signaling (class II)[7].While OsWRKY24, which negatively regulates both GA and ABA signaling in aleurone cells. It represents the third class of OsWRKY genes that are different from class I and II in regulating GA and ABA signaling pathways[1].
1.Like in aleurone cells, the expression of OsWRKY24 in rice embryos is not affected by GA, but slightly induced by ABA at some stages of the treatment
the OsWRKY24 was expressed at a relatively high level in the aleurone cells purified from dry seeds[5].When the embryoless half-seeds were treated with the buffer only or GA3 for 4, 24, or 24 h, the OsWRKY24mRNA level changed little in the aleurone cells. The ABA treatment did not affect theOsWRKY24mRNA much either at the 4 h time point, but slightly enhanced its expression at the 24 and 48 h time points. A similar pattern was observed for the samples treated with a combination of ABA and GA3[1].
2.OsWRKY24 represses GA induction of the low pI α-amylase Amy32b promoter
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0826400 |
|---|---|
| Description |
WRKY transcription factor 24 (WRKY24) |
| Version |
NM_001051210.1 GI:115440790 GeneID:4327518 |
| Length |
2565 bp |
| Definition |
Oryza sativa Japonica Group Os01g0826400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:37103829..37106393 |
| Sequence Coding Region |
37103963..37104223,37104338..37104541,37104739..37105325,37105413..37105574,37105684..37106137 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:37103829..37106393 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:37103829..37106393 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgacaacctcgtcgtccgggagcgtcgagacgtcggccaattcgcggctggggacgttctcgttcgccagcgcgagcttcacggacctcctcgggggaaacgcgggagccggcggcggaggtgtgtccaggtacaaggccatgaccccgccttcgctgccgctctcgccgccgccggtgtcgccgtcgtccttcttcaacagcccgatcggcatgaaccaggccgacttcctcggctcgccggtgctcctgacctccagtatcttcccgtcgccgacgacgggcgcattcgcgtcgcagcactttgactggaggccggaggtggcggcggcgcagagcgccgatcaaggcggcaaggacgagcagaggaattcctactccgacttctcgtttcagacggcgcctgcgagcgaggaggccgtgcgaacgacgactttccagccaccggtcccaccggccccactgggggacgaggcatacagaagtcagcagcagcagcagccatggggctaccagcagcagcctgcaggcatggacgcgggtgccaacgcggcgagcttcggtgcggcgccgttccaggcgacctcgtcggagatggcgccacaggtgcagggtggcggcgggtacagccagccgcagtcgcagaggcggtcgtcggacgacggctacaactggcgcaagtacgggcagaagcaggtgaaggggagcgagaacccccgcagctactacaagtgcaccttcccgaactgcccgaccaagaagaaggtggagcggtcgctcgacggccagatcaccgagatcgtgtacaagggcacgcacaaccacgccaagccgcagaacacgcgcaggaactccggctcgtcggcggcgcaggtcctgcagagcggcggcgacatgtcggagcattccttcgggggcatgtccggcacagcggcgacgcccgagaactcgtcggcgtcgttcggtgacgacgagatcagagttggctcccctcgggccgggaacggcggcggcgacgagttcgacgacgacgagccggattccaagagatggaggaaagacggtgacggcgaggggatctccatggctggcaaccggacggtgcgggaaccgagggtggtcgtccaaaccatgagcgacatcgacatcctcgacgacggctaccgctggagaaagtacggccagaaggtggtgaagggcaacccgaacccaaggagctactacaagtgcaccacggccggttgccccgtgcggaagcacgtggagcgcgcgtcccacgacctgcgcgccgtgatcaccacctacgaggggaaacacaaccacgacgtgcccgccgcgcgggggagcgccgcgctctaccgccccgcgccgccggcggcggccgccaccagcagccacccgtacctgccgaaccagccgccgcccatgtcctaccagcccacggggccacagccgtacgcgctgaggcccgacgggttcggcggccagggaccgttcggcggcgtggtcggcgggagcagcttcggcggcttctccgggttcgacgacgccaggggctcgtacatgagccagcaccagcagcagcagaggcagaacgacgcgatgcacgcctcgagagccaaggaagagcccggagacgacatgttcttccagaactcgctctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MTTSSSGSVETSANSRLGTFSFASASFTDLLGGNAGAGGGGVSR YKAMTPPSLPLSPPPVSPSSFFNSPIGMNQADFLGSPVLLTSSIFPSPTTGAFASQHF DWRPEVAAAQSADQGGKDEQRNSYSDFSFQTAPASEEAVRTTTFQPPVPPAPLGDEAY RSQQQQQPWGYQQQPAGMDAGANAASFGAAPFQATSSEMAPQVQGGGGYSQPQSQRRS SDDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITEIVYKGTHNHA KPQNTRRNSGSSAAQVLQSGGDMSEHSFGGMSGTAATPENSSASFGDDEIRVGSPRAG NGGGDEFDDDEPDSKRWRKDGDGEGISMAGNRTVREPRVVVQTMSDIDILDDGYRWRK YGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSA ALYRPAPPAAAATSSHPYLPNQPPPMSYQPTGPQPYALRPDGFGGQGPFGGVVGGSSF GGFSGFDDARGSYMSQHQQQQRQNDAMHASRAKEEPGDDMFFQNSLY</aaseq> |
| Gene Sequence |
<dnaseqindica>135..395#510..713#911..1497#1585..1746#1856..2309#caaactctctcttccctccacccccgcttcctccttcttcccgtacgtacacgccggaggccggacagagacacgaaccgcacggcgacgagctgtgagacgcggcggttttggtcgcgacctgagggattccgatgacaacctcgtcgtccgggagcgtcgagacgtcggccaattcgcggctggggacgttctcgttcgccagcgcgagcttcacggacctcctcgggggaaacgcgggagccggcggcggaggtgtgtccaggtacaaggccatgaccccgccttcgctgccgctctcgccgccgccggtgtcgccgtcgtccttcttcaacagcccgatcggcatgaaccaggccgacttcctcggctcgccggtgctcctgacctccagtgtaagcacgcacgcgaatgggccgagctccattaatggcctaatgccatgtcatttctgtacggtttttcagatgataatgagaaattgagaattgaaccttgccggttttcagatcttcccgtcgccgacgacgggcgcattcgcgtcgcagcactttgactggaggccggaggtggcggcggcgcagagcgccgatcaaggcggcaaggacgagcagaggaattcctactccgacttctcgtttcagacggcgcctgcgagcgaggaggccgtgcgaacgacgactttccagccaccggtcccaccggccccactggtgagtgagagcaaccataacgtcagctgttaccctttttggaggggtccttcgctgactttgtccaaaagaaactactcctagcatctttctttcttactcctagctaaggcattttcactatttcagtttgcaaattgcaatagtcaaaacccaaactatagaagtagcctctaaacaataaccttttctgacagggggacgaggcatacagaagtcagcagcagcagcagccatggggctaccagcagcagcctgcaggcatggacgcgggtgccaacgcggcgagcttcggtgcggcgccgttccaggcgacctcgtcggagatggcgccacaggtgcagggtggcggcgggtacagccagccgcagtcgcagaggcggtcgtcggacgacggctacaactggcgcaagtacgggcagaagcaggtgaaggggagcgagaacccccgcagctactacaagtgcaccttcccgaactgcccgaccaagaagaaggtggagcggtcgctcgacggccagatcaccgagatcgtgtacaagggcacgcacaaccacgccaagccgcagaacacgcgcaggaactccggctcgtcggcggcgcaggtcctgcagagcggcggcgacatgtcggagcattccttcgggggcatgtccggcacagcggcgacgcccgagaactcgtcggcgtcgttcggtgacgacgagatcagagttggctcccctcgggccgggaacggcggcggcgacgagttcgacgacgacgagccggattccaagagatggtgagtgccctgttcccaaacctcttcgcgccaaattatgtttgttgagataaaacagtgaactgaacatgttcaccataatatcaggaggaaagacggtgacggcgaggggatctccatggctggcaaccggacggtgcgggaaccgagggtggtcgtccaaaccatgagcgacatcgacatcctcgacgacggctaccgctggagaaagtacggccagaaggtggtgaagggcaacccgaacccaaggtaaataaagaacccaaaaagtccatttttcagttcgtctactggtgtgatcgcgcgtgtgtatctctcgtacttgtacttatcgtgcgtgctgctttcgtgtctgcaggagctactacaagtgcaccacggccggttgccccgtgcggaagcacgtggagcgcgcgtcccacgacctgcgcgccgtgatcaccacctacgaggggaaacacaaccacgacgtgcccgccgcgcgggggagcgccgcgctctaccgccccgcgccgccggcggcggccgccaccagcagccacccgtacctgccgaaccagccgccgcccatgtcctaccagcccacggggccacagccgtacgcgctgaggcccgacgggttcggcggccagggaccgttcggcggcgtggtcggcgggagcagcttcggcggcttctccgggttcgacgacgccaggggctcgtacatgagccagcaccagcagcagcagaggcagaacgacgcgatgcacgcctcgagagccaaggaagagcccggagacgacatgttcttccagaactcgctctactgactgaaagaatcgtcgtcgtaggaatctcaaagacatgacacgacggaaattgtagtttaggggggttttgtacttgtacgtacctaggatatactgtagtctttgatacatttgtttatttgtttggagggcccaggaatgcagatggctgcagaaaagggtaccgtcccttaacactggagatgggaggaaaggatgtactcctgtaggatacacagcaaattttgctctgtaatttttttcacatagaaaaatg</dnaseqindica> |
| External Link(s) |