Difference between revisions of "Os07g0587400"

From RiceWiki
Jump to: navigation, search
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
ZFP245is a cold- and drought-responsive gene that encodes a zinc finger protein in rice. The ZFP245 protein localizes in the nucleus and exhibits trans-activation activity. Transgenic rice plants overexpressing ZFP245were generated and found to display high tolerance to cold and drought stresses. The transgenic plants did not exhibit growth retardation, but showed growth sensitivity against exogenous abscisic acid, increased free proline levels and elevated expression of rice pyrroline-5-carboxylatesynthetase and proline transporter genes under stress conditions. Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress. Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic
 +
stress. When plants suffer from cold or drought stress, the ABA signal transduction pathway is activated and ZFP245 accumulates quickly. ZFP245 promotes the accumulation of free proline by activating the expression levels of pyrroline-5-carboxylatesynthetase and proline transporter genes, and enhances the ROS-scavenging ability in plant cells by activating the ROS-scavenging enzymes.Our data suggest that ZFP245 may contribute to the cold and drought tolerance of rice plants by regulating their proline levels and ROS-scavenging abilities and therefore may be useful in the development of transgenic crops with enhanced tolerance to abiotic stress.
  
 
===Expression===
 
===Expression===

Revision as of 10:29, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. ZFP245is a cold- and drought-responsive gene that encodes a zinc finger protein in rice. The ZFP245 protein localizes in the nucleus and exhibits trans-activation activity. Transgenic rice plants overexpressing ZFP245were generated and found to display high tolerance to cold and drought stresses. The transgenic plants did not exhibit growth retardation, but showed growth sensitivity against exogenous abscisic acid, increased free proline levels and elevated expression of rice pyrroline-5-carboxylatesynthetase and proline transporter genes under stress conditions. Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress. Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic stress. When plants suffer from cold or drought stress, the ABA signal transduction pathway is activated and ZFP245 accumulates quickly. ZFP245 promotes the accumulation of free proline by activating the expression levels of pyrroline-5-carboxylatesynthetase and proline transporter genes, and enhances the ROS-scavenging ability in plant cells by activating the ROS-scavenging enzymes.Our data suggest that ZFP245 may contribute to the cold and drought tolerance of rice plants by regulating their proline levels and ROS-scavenging abilities and therefore may be useful in the development of transgenic crops with enhanced tolerance to abiotic stress.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0587400

Description

Similar to Eukaryotic peptide chain release factor subunit 1-3 (eRF1-3) (Eukaryotic release factor 1-3) (Omnipotent suppressor protein 1 homolog 3) (SUP1 homolog 3)

Version

NM_001066672.1 GI:115473076 GeneID:4343757

Length

4045 bp

Definition

Oryza sativa Japonica Group Os07g0587400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:24565107..24569151

Sequence Coding Region

24565589..24566902

Expression

GEO Profiles:Os07g0587400

Genome Context

<gbrowseImage1> name=NC_008400:24565107..24569151 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:24565107..24569151 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtctgacagccatgaaactgataggaacattgagatctggaagattaagaagctaatcaaggctctggagtcagctagaggaaatggcacaagcatgatctctcttattatgcctccacgtgaccagattgcgcgagtggctaagatgttgggtgatgaatatggtaccgcctcaaacatcaagagtagagtcaatcgtcagtctgttttggctgccattacctcagctcagcagaggctgaagctctataacaaagttcctccaaatggattggttctctacactggaaccattgttactgaagatgggaaggaaaagaaggttaccattgattttgaacccttcaagcctatcaatgtatcactgtatctttgtgataacaagttccacactgaagctttgaatgagctcttggaatctgatgacaagtttgggttcattgttatggatggtaatggtactctttttggcacactaagtggcaacacacgtgaggtgcttcacaaattcactgttgatctcccaaagaagcatggtagaggaggacaatctgctttgcgttttgctcgtcttcggatggagaaacgccataattatgtccggaaaacagctgagcttgctactcagttcttcattaatcctgctacaagtcagcctaatgtttcaggcctaatcctcgctggttctgctgattttaagacagaattgagtcagtctgacatgtttgatcaacgacttcaagccaagatacttaatgtggttgatgtttcttatggtggcgagaatggtttcaaccaagctattgaattgtcagctgagattctagcaaatgtcaagttcatacaggagaagaagctaattggcaagtattttgaagagatcagtcaagatactgggaaatatgtctttggggttgatgacactcttaaagctcttgagatgggtgctgttgagactctaatagtgtgggagaaccttgaaaccaacagatatgtgcttaagaacagtgcatctggtgaaactgtgatcaaacattttaacaaagagcaggaagctgaccagagtaatttccgtgatccggctagtaatgctgagttggaagttcaggaaaaaatgtctcttctggaatggtttgctaatgaatacaagaagtttggttgctcgcttgagtttgtcactaataaatctcaagagggatctcagttttgtagaggattcggtggcattggtggtatcttgcgttaccagctagatatccggtcatttgatgagctttctgacgatgagggattgtatgaagactctgattag</cdnaseq>

Protein Sequence

<aaseq>MSDSHETDRNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQI ARVAKMLGDEYGTASNIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTIVTE DGKEKKVTIDFEPFKPINVSLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTL SGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATS QPNVSGLILAGSADFKTELSQSDMFDQRLQAKILNVVDVSYGGENGFNQAIELSAEIL ANVKFIQEKKLIGKYFEEISQDTGKYVFGVDDTLKALEMGAVETLIVWENLETNRYVL KNSASGETVIKHFNKEQEADQSNFRDPASNAELEVQEKMSLLEWFANEYKKFGCSLEF VTNKSQEGSQFCRGFGGIGGILRYQLDIRSFDELSDDEGLYEDSD</aaseq>

Gene Sequence

<dnaseqindica>2250..3563#atctctctctctctccgaaacagccgaccacaccagaagttcagaggcgagggtttcccacccgcgagaagtcggcgctcccctcttcctcctcctccctcctcctcggtaaggaaaccctagcccctcctcctcttcctccctcctgcgccccctcgatccgatcccgtctcgtgcttcttctcccccgatcgttcggagctgcgtgggtgcggcggatcgggagcaggttggatctgttgaatcgtcgcgggttgtgttgttttcatggttcgtgtggtcgtcagatttggtcgagattagagtctggatccggtgtactggtagcgcgaggtggatcgggagtgattgggacctagttctgtggcgaaatttctagggcgtgtagtgatccttcgcctcccggtctcgggatctgtgcgggaagtactctagatggctgttccgcgcgattttcctgatttaggccactaatttaggtggatgtatttggatccatgctgtgtttgtaagttgtaattgcctgccaggagatggctttgtttgttggctatttgaagtagcgtactgggatgtgtattaacataggaatacatgctattttccatcgtggatattaatcgggttattttgattccttaatgcttggagttattgtcatattagacgagccttcctgctatggtgccatgcggacatgcggttactcaagttcacggcgctctttttagcgttgttggtttgaaaattacatgttatatgtcttcttcatggttgcattctgctcttgtatgttttgttgcgctaatagtttccttttcattggtgatgtatcatttaggttaacttgaagtagtagtgagcattgagcaaactatgtgttttttttctgaatttacatgattttaaagattcaaacattctgaaatctgtagattgctgcacgtttgccttattgattttggaagtaactggtaactgaaaatgtatgtgctggactgctagtagaacatgaactagaaggaataccccttgatgaacatggcaatcaagaagttaagaaggtttcttgatcttctatgactctggtagcttgtaaagacaaaacactgaccatgtcaatgtcaatgcaacttctataaatttatgccattcgatcttaaaatgttagcctgaggtttagttcttatcttctatcttagtcttggtgacagatgcatgtttggtcttacaatgatttactttaattatattgattgcctatagttaattttttattacattgttggcagaagataaatacatctaagatgtgctgttttaactttattgactgattatattccatatttcattgttttgtgattttccaagttgatatctagttgactagtactaattgtactttccgtttgtttcatgagtgtactctctatttcggttttgtgattattgaaactaaattctgtttcttggatataatttagattttatgttggttttattattttatctgggtgacattccgattctgaaaattttacatggctatgcaggtccttcatttgtcttgggggttaactccatgctttattttatttcagtatgtttgtcccacataaaaaatgttaccaagtacctgtaacctagtgataacatcgtatgtgttcatgattgtttcatgttagctgcaaaaatcatttgagtatatgcaaatgaaaacctttttcacatttcgtaacctaccttttcctaaaccaaaccaaaatttgccacccattgggcaatattaaccttgtctgctgagtgttgtggtttaattttaaccttgtctgctgagtgttgtggttatttgatagtacctttgctgccgaaattttgttgtgagatatttagtaagataaacggtggttgtttttcttgttctttcactgtgttacgtataaagtaatagagcatgctgctttgaagaaatcagtctcattattgattaatttgtacaggagacaggtatcatttcttatttagcatgtccatgtccaatttggtatcatgaacagagcttgtgtcaacaagaaagttgaatgtactatataacaataatatgacttgtctttgttctgtgtttttttttaatctgtttgcaagtttttcttgagtgaactgtctggttaatgttcccttcaaatcccttatatccctgtgttttggcattgtacaggtgagccagtcatccaagctctgtcaagatgtctgacagccatgaaactgataggaacattgagatctggaagattaagaagctaatcaaggctctggagtcagctagaggaaatggcacaagcatgatctctcttattatgcctccacgtgaccagattgcgcgagtggctaagatgttgggtgatgaatatggtaccgcctcaaacatcaagagtagagtcaatcgtcagtctgttttggctgccattacctcagctcagcagaggctgaagctctataacaaagttcctccaaatggattggttctctacactggaaccattgttactgaagatgggaaggaaaagaaggttaccattgattttgaacccttcaagcctatcaatgtatcactgtatctttgtgataacaagttccacactgaagctttgaatgagctcttggaatctgatgacaagtttgggttcattgttatggatggtaatggtactctttttggcacactaagtggcaacacacgtgaggtgcttcacaaattcactgttgatctcccaaagaagcatggtagaggaggacaatctgctttgcgttttgctcgtcttcggatggagaaacgccataattatgtccggaaaacagctgagcttgctactcagttcttcattaatcctgctacaagtcagcctaatgtttcaggcctaatcctcgctggttctgctgattttaagacagaattgagtcagtctgacatgtttgatcaacgacttcaagccaagatacttaatgtggttgatgtttcttatggtggcgagaatggtttcaaccaagctattgaattgtcagctgagattctagcaaatgtcaagttcatacaggagaagaagctaattggcaagtattttgaagagatcagtcaagatactgggaaatatgtctttggggttgatgacactcttaaagctcttgagatgggtgctgttgagactctaatagtgtgggagaaccttgaaaccaacagatatgtgcttaagaacagtgcatctggtgaaactgtgatcaaacattttaacaaagagcaggaagctgaccagagtaatttccgtgatccggctagtaatgctgagttggaagttcaggaaaaaatgtctcttctggaatggtttgctaatgaatacaagaagtttggttgctcgcttgagtttgtcactaataaatctcaagagggatctcagttttgtagaggattcggtggcattggtggtatcttgcgttaccagctagatatccggtcatttgatgagctttctgacgatgagggattgtatgaagactctgattagcaatcagccaatcacatgactgtgctggcccagggaaggacgccgcagctgcaacgagtctgattcgctctacttacgcaggaacacttcgaaagcagctgtatgcatattaattctttggtcttgctcaaattattttggttactttctcatgctataatgtaaacttgactattcctctcctctgtttcagatccagaaattgatgggcgtgggccagcctcatcctatgctggaagggattaaggcgaaaggattactgagtcacatcatcatgatagtaatgtgtcaagaagttatcgaacttaaaaggcatgctgttgccaaggtcgtactggttgtctattgtctgctttttgcaactatattcgcaagttctgaattctagtgtctgcttgaaattgagcacgctggacgcgctcgtgactatatggtgtaatctgctacttttgcagtttttgcaatgaagttactgttatgct</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0587400, RefSeq:Os07g0587400