Difference between revisions of "Os02g0477700"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 6: Line 6:
  
 
Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, we observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c). Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets). These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components. These results are consistent with the results reported by Nishikubo et al. (2000). Nishikubo et al. also reported that parenchyma cells in F71 ectopically deposit polysaccharide-linked hydroxycinnamoyl esters in their cell walls. Thus, the d50 mutation in F71 appears to induce abnormally shaped and sized cells and ectopic deposition of cell wall components specifically in the parenchyma of elongated internodes. In other organs such as roots and leaves, abnormally shaped cells were not observed.
 
Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, we observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c). Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets). These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components. These results are consistent with the results reported by Nishikubo et al. (2000). Nishikubo et al. also reported that parenchyma cells in F71 ectopically deposit polysaccharide-linked hydroxycinnamoyl esters in their cell walls. Thus, the d50 mutation in F71 appears to induce abnormally shaped and sized cells and ectopic deposition of cell wall components specifically in the parenchyma of elongated internodes. In other organs such as roots and leaves, abnormally shaped cells were not observed.
[[File:Figure 1.jpg]]
+
[[File:Figure 1.jpeg]]
  
 
===Expression===
 
===Expression===

Revision as of 11:53, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, we observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c). Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets). These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components. These results are consistent with the results reported by Nishikubo et al. (2000). Nishikubo et al. also reported that parenchyma cells in F71 ectopically deposit polysaccharide-linked hydroxycinnamoyl esters in their cell walls. Thus, the d50 mutation in F71 appears to induce abnormally shaped and sized cells and ectopic deposition of cell wall components specifically in the parenchyma of elongated internodes. In other organs such as roots and leaves, abnormally shaped cells were not observed. Figure 1.jpeg

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0477700

Description

Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein)

Version

NM_001053379.1 GI:115446128 GeneID:4329359

Length

4131 bp

Definition

Oryza sativa Japonica Group Os02g0477700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:17139056..17143186

Sequence Coding Region

17142042..17142192,17142278..17142399,17142943..17143185

Expression

GEO Profiles:Os02g0477700

Genome Context

<gbrowseImage1> name=NC_008395:17139056..17143186 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:17139056..17143186 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>tctccagggcctattgacaacattatgcgttctactttgattgaggctgagccattatacaaacaatttgaatacatgaaagtgttggtgggttcttggaatgtcgggcaagaaaaggcatcttatgagtcactaagagcttggctaaagttaccgacaccagaggttgggttagtggtagttggattgcaggaggtggacatgggtgctggttttcttgcaatgtctgcagctaaagaaacagttgggctagagggaagcccaaacggagattggtggttggatgcaattgggcagcagttaaagggttactcttttgagcgtgttggctcgaggcagatggctggattgcttatctgtgtatgggtcagaacacatcttaagcagttcattggtgatattgataatgctgcggtagcatgtggattagggcgagcaatcggcaacaaggtacttctgttatcttattgccccactctttcttggcgcaagatgagcttgaaatgttgtttatga</cdnaseq>

Protein Sequence

<aaseq>SPGPIDNIMRSTLIEAEPLYKQFEYMKVLVGSWNVGQEKASYES LRAWLKLPTPEVGLVVVGLQEVDMGAGFLAMSAAKETVGLEGSPNGDWWLDAIGQQLK GYSFERVGSRQMAGLLICVWVRTHLKQFIGDIDNAAVACGLGRAIGNKVLLLSYCPTL SWRKMSLKCCL</aaseq>

Gene Sequence

<dnaseqindica>995..1145#788..909#2..244#atctccagggcctattgacaacattatgcgttctactttgattgaggctgagccattatacaaacaatttgaatacatgaaagtgttggtgggttcttggaatgtcgggcaagaaaaggcatcttatgagtcactaagagcttggctaaagttaccgacaccagaggttgggttagtggtagttggattgcaggaggtggacatgggtgctggttttcttgcaatgtctgcagctaaagaaacagtaagtcaagtttaagttctagtttttttaattaaagttatttgaacacatgtttttgttatttacttgcacttagtcatctgctactattatacagaccaaatcctagtaacactgaacaagagtgttgttagacatcttgctcttgttgattttttttgttgaataatcattatcattatgtataagatacctcgttgtacaaatgtacaatgttatcttgaccacaaaaaaatacgcttgtttgacaggctgtacctcttttctctatcagtatgattagagttaagctattttttgccacagttttattaaatgtctacaatacaacactgattggcacaggatccatgtgccatccttgcaatgagtggcagcatatggatgaaactcaatgacacaatgatttaaccttgtcttgcactcttgctaaagatcgttctgccgttagacttcccaagaatattaataaagtataacatgaaactggcatggtttttgctacttctaatcctgatacttttgtacgtccacttgctttaggttgggctagagggaagcccaaacggagattggtggttggatgcaattgggcagcagttaaagggttactcttttgagcgtgttggctcgaggcagatggctggattgcttatctgtgtatggtaatctgttcaggacttattttatcctgcagcttcatctgccttttgtttgtgtataaattattcagtttcttctttttctcagggtcagaacacatcttaagcagttcattggtgatattgataatgctgcggtagcatgtggattagggcgagcaatcggcaacaaggtacttctgttatcttattgccccactctttcttggcgcaagatgagcttgaaatgttgtttatgaggcatttgacttatcaaacatatcatgacaaattttgttttgatctaagcatttcatgctttagccatcatatttattggagatgtgttcatattctggaacatttgagttaagggggggaatacctttgctggccactatatgccaaaactccctttcatgtttaagcacaatgctgattagttcattctagagaaaggtagcaaggaggataagatataccatataggcatacagtatataataaaaaggaatatatgctatatgatggaaatgtagtgtgacagcaagtgctatttgatttgttttctttcatgcattcacatgttgaacattgtttgtttacttgtttaaaatgaacatcttggaagttctgaaagttcaagttgttaacgatgcactaagcaaaaagattattcacatttgtccccatattcatttggtagcagttgttgtgcaaaaccaataaatcattgttaccaagatgatatctggtggtttgtgcatacaattaatgaatgagaggtgtgcaatactgatcagaaaatgaaaaaaaaaagacaaattttaaaacacattatgggcctaaaatgtaaccacccactagttctgttatttttctgggggagtacagatattacttcaaaaggactgtattctgtcttatctgctgctttgttcatgtatgcctatattagggagcagtgggattgaggatgagaatacatgataggagtatttgctttgtaaattgccattttgctgctcatatggaagctgtgagtcgacggaatgaagattttgaccatgtctttagaacaatgacctttgccaccccttcgagtggaataatgacaacatcaggtgtttgttcaaccttttcccattatttttcagtattttccaatgggcattcaagtcaaatgacctgtaaatttgttgtgatattacaatcagcaatgagcaaatcttatacactgttacttgttttggtggtcttgcagtttctagttctactggccagcttcttcgaggagcaaatgtatggtgtattaatgttggttcattacattttctcggtggatagggagtagattctcatcttgatatactaagttgttcctattataatttacagggatcaagaatgcctgagttgtcagacacggacatgattgtctttcttggtgacttcaattaccgcctttatgatatttcctatgatgatgcaatgggcttagtttcccggagatgctttgactggctaaaaaataatgaccaactgcgagcagaaatgagatctgggagagtcttccagggactacgtgaaggggatttcaagtttccccctacatacaaatttgagaaacatacagcaggcttatcaggtatcttactttgttttttattcgtggaatcccaaagtacatataaagatcatcacctttatttgtcatatagggtatgatagcagtgagaagaggcgcattcctgcctggtgtgacagaatcctatatcgtgatagccgagttagttcagggaatgagtgttccttggattgtcctgtggtttcttcaatatcactgtaagttatttgttgtgcatgtttttttttaacccgaaaaagcttaaaatatgtcaataccttgttattatgttttccaggtatgactcttgcatggaagcaacagatagtgatcacaaacctataaaatctgtgttcaatttggatattgcttatgttgacaaacagacaatgaggcagaaatatgtggagctaatgagctcaaataataaagtggtgcatttgcttcaggaacttgaagcattccctggagtaaatataaataattctaacatcatcttgcaagatcggaatccatctgttgtgaaattgcaaaacagaacagaagtcatcgcttgttttgagatcattggacaagcaccaaatttgtccagcacacatttctctgcttttcctgcatggctaaaggtgagtcaatgctttgtctgactccttttactgtatttttattaaaataatctaatactagcaacgtacaaaaactttgcacgaccgaatttctcatgttttacatgggcacaactgcagagtagtagaaatattagtctcttcagtatcaagagttatgacaaaagagagcatatggtttcagttatactccctccgtttcaggttataagacgttttgactttggtcaaagtcaaactacttcaaatttgattaagtttatagacaaatatagtaatatttataatactaaattagtttattaaatcaataattgaatatatttttataataaatttgtcttgggttgaaaatgttattattgttttctacaaacttagtcaaacttgaagtaatttgactttgaccaaagtcaaaaacatcttataacctgaaacggaggtagtagtagattgacgcgttggcattagtaaaggcagactccagaatttgttattacttgttttgcttgttttattcttcaccattattaattcactgttgtgagcttaatgttttgaaaactgtgggcatatattcaatataggtctctccagcagtcggcataatatctccgggacagacggtagaggtcactttgcagcacagagacctgcatagccaacaaaactataatggaacttcattggatattttgcctggtggagctacccaacaaaaggcagcaactgtttttgcgaaaataactggagtatattcaacagttgcaaaatattacgaaatacatgtacaacaccagaactgcaggagcacattgccatcgagaggttataacttaggtgaccggtttttttaattttgagtttggtatcaggaatttaggaaatgtatgttgtatcaaatgttctttttgagtgaagtcacaaaatcaaggctttctactaccctcaacatgtgtattttcaagagaggaaaattgtaaacagtgtagc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0477700, RefSeq:Os02g0477700