Difference between revisions of "Os12g0102400"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 22: Line 22:
 
Investigation on the dynamic expansion and genomic localization of rice RING finger protein genes over evolution revealed only two RING-C2 type protein genes located on the distal part on each of rice chromosomes 11 and 12 (Lim et al., 2010).
 
Investigation on the dynamic expansion and genomic localization of rice RING finger protein genes over evolution revealed only two RING-C2 type protein genes located on the distal part on each of rice chromosomes 11 and 12 (Lim et al., 2010).
  
The finding that the distal regions of rice chromosomes 11 and 12 diverged 70–90 Mya and may have undergone frequent illegitimate recombination such as gene conversion (Paterson et al., 2009; Wang et al., 2011) raises the question regarding the evolutionary fate of OsRINGC2-1 and OsRINGC2-2 located on the distal parts of these chromosomes.We attempted to choose each of 10 OsRINGC2-1 and OsRINGC2-2 neighboring genes, respectively, and 100 randomly selected duplicate genes, which were generated by whole-genome duplication elsewhere in the genome. Strikingly low Ka, Ks, and dsm values were observed between duplicate genes (but not all) located on the distal parts of chromosomes 11 and 12 as compared to those of random sets (Fig 3).
+
The finding that the distal regions of rice chromosomes 11 and 12 diverged 70–90 Mya and may have undergone frequent illegitimate recombination such as gene conversion raises the question regarding the evolutionary fate of OsRINGC2-1 and OsRINGC2-2 located on the distal parts of these chromosomes.We attempted to choose each of 10 OsRINGC2-1 and OsRINGC2-2 neighboring genes, respectively, and 100 randomly selected duplicate genes, which were generated by whole-genome duplication elsewhere in the genome. Strikingly low Ka, Ks, and dsm values were observed between duplicate genes (but not all) located on the distal parts of chromosomes 11 and 12 as compared to those of random sets (Fig 3).
  
 
[[File: liu-Os12g0102400-Fig2.jpg|right|thumb|200px|''A phylogenic tree of RING-C2 type genes in Viridiplantae. The numbers on the left side indicate percent bootstrap values.  Solid circles indicate OsRINGC2-1 and OsRINGC2-2. The species abbreviations are listed as follows; At, Arabidopsis thaliana; Al, Arabidopsis lyrata; Cp, Carica papaya; Cs, Cucumis sativus; Rc, Ricinus communis; Me, Manihot esculenta; Gm, Glycine max; Mt, Medicago truncatula; Bd, Brachypodium distachyon; Zm, Zea mays; Os, Oryza sativa, Sb, Sorghum bicolor; Si, Setaria italica; Ac, Aquilegia coerulea; Pp, Prunus persica; Pt, Populus trichocarpa; Mg, Mimulus guttatus; Sm, Selaginella moellendorffii; Vv, Vitis vinifera. (from reference <ref name="Jung" />).'']]
 
[[File: liu-Os12g0102400-Fig2.jpg|right|thumb|200px|''A phylogenic tree of RING-C2 type genes in Viridiplantae. The numbers on the left side indicate percent bootstrap values.  Solid circles indicate OsRINGC2-1 and OsRINGC2-2. The species abbreviations are listed as follows; At, Arabidopsis thaliana; Al, Arabidopsis lyrata; Cp, Carica papaya; Cs, Cucumis sativus; Rc, Ricinus communis; Me, Manihot esculenta; Gm, Glycine max; Mt, Medicago truncatula; Bd, Brachypodium distachyon; Zm, Zea mays; Os, Oryza sativa, Sb, Sorghum bicolor; Si, Setaria italica; Ac, Aquilegia coerulea; Pp, Prunus persica; Pt, Populus trichocarpa; Mg, Mimulus guttatus; Sm, Selaginella moellendorffii; Vv, Vitis vinifera. (from reference <ref name="Jung" />).'']]

Revision as of 13:30, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

It is a gene encoding RING-C2 type protein in rice, called OsRINGC2-2 located on chromosome 12 function as E3 ligases.

The sequences of both genes displayed highly significant identities of 99% (3271/3295) at the nucleotide level (data not shown). In particular, no differences between the two genes were found in both the 5′-and 3′-terminal sequences, indicating that gene-specific primer pairs cannot be designed to clone the full-length genes. We further examined the differences between the sequences, which are recognized by any restriction enzyme, and found that one single nucleotide polymorphism displayed a difference in recognition of the HindIII endonuclease (Fig. 1A).


Gene identification via enzyme digestion. A: Schematic diagram of the pBIN35S-RINGC2 constructs. Restriction enzyme sites are indicated. B: Restriction profiles of each genes.. (from reference [1]).

Expression

It is a gene encoding RING-C2 type protein in rice. Two RING-C2 types are the modified types of canonical types RING-H2 and RING-HC. Some modified types of RINGs including RING-v, RING-D, RINGS/T, RING-G, and RING-C2 exist in various plant genomes. Interestingly, only two RING-C2 types exist in the rice genome, whereas 10 occur in Arabidopsis and 10 in apple, respectively. Functions of the modified RING domains remain largely unidentified.

Subcellular localizations were strikingly different; OsRINGC2-1 was found only in the cytoplasm with many punctate complexes, whereas OsRINGC2-2 was observed in both the nucleus and cytoplasm. The expression patterns of both genes showed striking differences in response to salt stress, whereas plants heterogeneous for both genes mediated salt tolerance in Arabidopsis, supporting the notion of concerted evolution.

Evolution

Complete genome sequences and bioinformatics provide new insights into the evolutionary history of plant genomes. In particular, the Poaceae genome, which includes major food crops such as rice, wheat, corn, and sorghum, is believed to have undergone a pregrass whole-genome duplication event with a common ancestor 70–90 million years ago (Mya)(Paterson et al., 2009; Salse et al., 2008, 2009; Wang et al., 2005) followed by independent gene loss during speciation.

Investigation on the dynamic expansion and genomic localization of rice RING finger protein genes over evolution revealed only two RING-C2 type protein genes located on the distal part on each of rice chromosomes 11 and 12 (Lim et al., 2010).

The finding that the distal regions of rice chromosomes 11 and 12 diverged 70–90 Mya and may have undergone frequent illegitimate recombination such as gene conversion raises the question regarding the evolutionary fate of OsRINGC2-1 and OsRINGC2-2 located on the distal parts of these chromosomes.We attempted to choose each of 10 OsRINGC2-1 and OsRINGC2-2 neighboring genes, respectively, and 100 randomly selected duplicate genes, which were generated by whole-genome duplication elsewhere in the genome. Strikingly low Ka, Ks, and dsm values were observed between duplicate genes (but not all) located on the distal parts of chromosomes 11 and 12 as compared to those of random sets (Fig 3).

A phylogenic tree of RING-C2 type genes in Viridiplantae. The numbers on the left side indicate percent bootstrap values. Solid circles indicate OsRINGC2-1 and OsRINGC2-2. The species abbreviations are listed as follows; At, Arabidopsis thaliana; Al, Arabidopsis lyrata; Cp, Carica papaya; Cs, Cucumis sativus; Rc, Ricinus communis; Me, Manihot esculenta; Gm, Glycine max; Mt, Medicago truncatula; Bd, Brachypodium distachyon; Zm, Zea mays; Os, Oryza sativa, Sb, Sorghum bicolor; Si, Setaria italica; Ac, Aquilegia coerulea; Pp, Prunus persica; Pt, Populus trichocarpa; Mg, Mimulus guttatus; Sm, Selaginella moellendorffii; Vv, Vitis vinifera. (from reference [1]).
Sequence divergence of duplicated genes pairs in upstream and downstream of Os11g01190 and Os12g01190.. (from reference [1]).

Labs working on this gene

Plant Genomics Lab, Department of Applied Plant Sciences, Kangwon National University, Chuncheon 200‐713, Korea

Reference

Jung, Chang Gyo, Lim, Sung Don, Hwang, Sun-Goo, & Jang, Cheol Seong. (2012). Molecular characterization and concerted evolution of two genes encoding RING-C2 type proteins in rice. Gene, 505(1), 9-18. doi: http://dx.doi.org/10.1016/j.gene.2012.05.060

Lim, S.D., et al., 2010. A gene family encoding RING finger proteins in rice: their expansion, expression diversity, and co-expressed genes. Plant Mol. Biol. 72, 369–380.

Paterson, A.H., et al., 2009. The Sorghum bicolor genome and the diversification of grasses. Nature 457, 551–556.

Wang, X., et al., 2005. Duplication and DNA segmental loss in the rice genome: implications for diploidization. New Phytol. 165, 937–946.

Structured Information

Gene Name

Os12g0102400

Description

Zinc finger, RING-type domain containing protein

Version

NM_001071769.1 GI:115486859 GeneID:4351244

Length

6708 bp

Definition

Oryza sativa Japonica Group Os12g0102400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:104922..111629

Sequence Coding Region

105119..105120,105421..105520,105598..105725,105939..106101,106198..106310
,107026..107109,107193..107241,107331..107422,107680..107809
,107906..107982,108058..109676,110024..110221,110287..110825

Expression

GEO Profiles:Os12g0102400

Genome Context

<gbrowseImage1> name=NC_008405:104922..111629 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:104922..111629 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatgaccatgagcgacgatggagaccgcacctgcccgctctgtgctgaggacatggacatcactgaccagcagctcaagccctgcaaatgcggctatgagatttgtgtctggtgctggcaccacatcattgatatggctgagaaagaggacactgagggccgctgccccgcatgccgcactcgctatgacaaagataggattgtcaagatggctgccacttgtgacaggacggtagtggagaaaaatgtggacaagaaacagaagacccaaaaggtcaagtcaaaggccgcggtaactgtggaagctaagaaacatcttgctagcgtcagggttatccagagaaacctcgtgtacataattggactacctgcaaatttatgcaacgaaagcatacttgagcgcagggaatactttggtcagtatggcaaggttctgaaagtttcagtttctcggccgactggggctccttcccagcaggcaccaacaaacaacagtatcagcgtatatattacatatgccaaagaagaagaggccatcaggtgtattcaagctgtacacaattttgttttggaagggaaagtgttaagagcgtgctttggtactacaaagtattgccatgcatggctgcggaacatgacctgtggaaatccagattgtctctatttacatgatgtaggaagccaggaagatagtttcactaaagatgagataatctcagcatatacaaggagtagggttccccaaatggcgtctaatgtttctcaaagacgcgcagggactgtattacctcctccagcagaagatttctcatatagtgcagtggttgcagctaaacatccaatcaagaatggaataactaatactgcaaatcaatccaggctttcgcctccaaacagtagttctgggagatccacacttccaccagctgcttcatgggggcatcgcgatttgaataccaggacaacagcaactggggtggcatcgtcacaatctcttactaaatcaaaagcagatcctcaaagtaattcattctcgagttcttcgactgtttcaagtacaaaactaccttcttcatggaatgatgacacaagcacagttccgaaaatgacggaaggacgagatagtttgtctaaaaccttgaagccatataagcctggtattgcaaaggaaacccaagctgtaacatcactggagtcatcgcttgacatagacttctctaccataccttcagcttggaacgatgatgatgtcacatcagatggcatgtcaaaaggaagtgacgagaagcaggttgtaaatgacaatggaaagtttgaatgttcagtttcttcaaagccagctgaatcagggcatcttacatcgaagtcaacgacatcaccaaagaaagacatcgcagtaaacagtaccaggcaaagtcctctaaattgtgtatcaagtccatcggtttctaaatcagaagtaaaggatggtgatggtgattaccaagtaaccaacatggcttctaaaacatctactttggtaattagaaaggaccaatctaatcaagcagctattgacacagcaaccgaagatactagatctgagagcacggatattgataggctttctgttggagtatcttcagtaacattaagcagaaaagatggggttcaaagtattgccgaaaaccaacaaccggatgcaatcctaagtacttcagttgtggtgccctttagtcagaatttgaaacttgctgagtgtaatgattctacatgtcagcctagttcagataagcatcgtgattggtgttcagatatccagagtagtgtgtctcctcagttaaatgacatagaaagttatgcagtagccactgataaatctcatggtagagtgctggatgctgctgatcaagcttcgtcttcaccatatgtccatttccctaacactgctcctatttcactgtggaatggtaaagagattaaccatacatcaacaagtgatagaacttccacaatgatgcaacctgggctgttatcttcagttgacagcacttctaccatgttaaatggacatcaagaagggctagggactatatatgcacctggtaaggtttctgaacatcctagaatgaaaaaccatcagcctggagcagttggtgcagtgagaattgataacataggcagttttgacaaggctgtaagtgtaaataaggatgagagcagcataattgctgatattttgtctttggagtttgatccatgggatgagtcgtattcaacggctaacaattttgctaagatgcttagtgcatctgaaaagaacgatgtgctttttgatgcacgttcatggaaaacaaaaaccagcaatagtgagtctagattttcatttgctagacaagataatcaaggaagcctcctagattcatctatgagaaattataaaagtgagcagaatttcagtttgccatcccagaattctcatggaaacatttatcagagtggcattgcatttcaatctcctgaggaaggtttctcaaagagcaactctcttactatgttggatatgctagctaccggcacatcaaagcctaaagtatccgcgcctcctggattttcagcaccagcaagagttcctactgggttttcttctggattttcatcccatgaggggttgaatccacctccaggattttcatctcataatgggcctaatccccctcctggattttcttctcagggtgggtctaatcagatctatggttcggcatactcagaaactcgcccatttgatgatcttttgggtataaatactagccattatcaaccacagttagctagacaaacaagtgatatagaatttgttgatcctgctatattggctgtgggtaaagggcggatgcctggaataagtgattcagggttggagatgaaaacttcccatacttttccttcgcagttgcaaacatcaaatgatccaaggtttcaattacttatgcagcagaacatgccttcccatcaaaatgttggatttgcagaacatgttcaagatgcattcaaccctatgaatgataattatcttgcatcccgacttatacctcagaaccatggttctctatcctcttacacacagatgtcactccaacaacctagaagctcacatcttacaaatggtcattgggatggctggggtgatttgagacaagggaataatgtttccatgcctgacatgtcaaggatgttatatccaactgaagcaaacaacttccacatgctgggttcaaatgatctgtataacagagcttttggactgtga</cdnaseq>

Protein Sequence

<aaseq>MMTMSDDGDRTCPLCAEDMDITDQQLKPCKCGYEICVWCWHHII DMAEKEDTEGRCPACRTRYDKDRIVKMAATCDRTVVEKNVDKKQKTQKVKSKAAVTVE AKKHLASVRVIQRNLVYIIGLPANLCNESILERREYFGQYGKVLKVSVSRPTGAPSQQ APTNNSISVYITYAKEEEAIRCIQAVHNFVLEGKVLRACFGTTKYCHAWLRNMTCGNP DCLYLHDVGSQEDSFTKDEIISAYTRSRVPQMASNVSQRRAGTVLPPPAEDFSYSAVV AAKHPIKNGITNTANQSRLSPPNSSSGRSTLPPAASWGHRDLNTRTTATGVASSQSLT KSKADPQSNSFSSSSTVSSTKLPSSWNDDTSTVPKMTEGRDSLSKTLKPYKPGIAKET QAVTSLESSLDIDFSTIPSAWNDDDVTSDGMSKGSDEKQVVNDNGKFECSVSSKPAES GHLTSKSTTSPKKDIAVNSTRQSPLNCVSSPSVSKSEVKDGDGDYQVTNMASKTSTLV IRKDQSNQAAIDTATEDTRSESTDIDRLSVGVSSVTLSRKDGVQSIAENQQPDAILST SVVVPFSQNLKLAECNDSTCQPSSDKHRDWCSDIQSSVSPQLNDIESYAVATDKSHGR VLDAADQASSSPYVHFPNTAPISLWNGKEINHTSTSDRTSTMMQPGLLSSVDSTSTML NGHQEGLGTIYAPGKVSEHPRMKNHQPGAVGAVRIDNIGSFDKAVSVNKDESSIIADI LSLEFDPWDESYSTANNFAKMLSASEKNDVLFDARSWKTKTSNSESRFSFARQDNQGS LLDSSMRNYKSEQNFSLPSQNSHGNIYQSGIAFQSPEEGFSKSNSLTMLDMLATGTSK PKVSAPPGFSAPARVPTGFSSGFSSHEGLNPPPGFSSHNGPNPPPGFSSQGGSNQIYG SAYSETRPFDDLLGINTSHYQPQLARQTSDIEFVDPAILAVGKGRMPGISDSGLEMKT SHTFPSQLQTSNDPRFQLLMQQNMPSHQNVGFAEHVQDAFNPMNDNYLASRLIPQNHG SLSSYTQMSLQQPRSSHLTNGHWDGWGDLRQGNNVSMPDMSRMLYPTEANNFHMLGSN DLYNRAFGL</aaseq>

Gene Sequence

<dnaseqindica>198..199#500..599#677..804#1018..1180#1277..1389#2105..2188#2272..2320#2410..2501#2759..2888#2985..3061#3137..4755#5103..5300#5366..5904#acgcgaacacgacgacaccagccagcaagcagcggaggagagagagagagagagagagactccatagacggccatcgatcgtacgcgactccccccatccatccatccacccgccggcgccccctccctctcatcgatcgatcgattcccaccgccgcccccgttttgaccacctacctagggtttcccccatcggaatgtgagtacttcaccctctctgatcccccccttttcttttctgattgttgctccaatccacttgggagcataatagactctttggattggatcctcgatttgaaggatcagcccctgcgcttgcccccccacccctcactttctcgtttattcgatttgatgataggaagcttctctctcttattagggattgattgattacaccgtgttactacagattgttattcccacaaacaaacaatctcatgtactactaataatattatctttcatgtctcctgccgctgaattgctcccgaaggatgaccatgagcgacgatggagaccgcacctgcccgctctgtgctgaggacatggacatcactgaccagcagctcaagccctgcaaatgcggctatgaggtttcttcccttccctccccaccactctactctccacaccccccttccattcacctcccttttgcatctcactgcagatttgtgtctggtgctggcaccacatcattgatatggctgagaaagaggacactgagggccgctgccccgcatgccgcactcgctatgacaaagataggattgtcaagatggctgccacttgtgacaggtccctccatctcaaaccgtcttttttcctttcacctcactaactgcactgacatgcgaagatggccgcacaagagcttagggtcttcagttcaacaaaacgaaacatcacccagttgtcgtgaattgtggtttgcaaagcgccataagcaacttcttttacctgtctatcgcatcggaaattttgtacttatgcttcttttaatggaaacaggacggtagtggagaaaaatgtggacaagaaacagaagacccaaaaggtcaagtcaaaggccgcggtaactgtggaagctaagaaacatcttgctagcgtcagggttatccagagaaacctcgtgtacataattggactacctgcaaatttatgcaacgaaagcgtgagtaccatattgtgcacagacagattcttttcaactgagtaatgtgtatattttgtttctcaccttggcaacacaattcattttttatttcagatacttgagcgcagggaatactttggtcagtatggcaaggttctgaaagtttcagtttctcggccgactggggctccttcccagcaggcaccaacaaacaacagtatcagcgtgtatgtttatgtgaatctcatgccacatgtttatgatgtttctctcatggataaacatgacctattatttcaagtgattagatatatcttaccgtatgtacaagtggtgttttcaagttatgctctcctgtactttccaagcctagagcatttaagcataggtgatttattgttgagaaattatatgcttaaatatagatgaaaatgatggctaattcaaatatgatatgtccatgttcttgcaattaatttcagatttatattacctacttaacagtatgatttgactaaggatcatgaatttccatatccatttgtgaatcagtgaatgccacacctagcagcctagtagccaaagcaaaagatgtagatttctagtgttgaataatcagataaatgcaaacgtgactgcttcagtcatatcatgatcattatattaactatggtatgtactaattgtatgtttacatcataagtctgattgagctcagaacctttgcatatgcagatgtcaggtatttcatagaatttacctcaaggattatcaaaattttcctgtctgagcactttgtagttctttgaatgcagctccatctttctcttaggaatcctcagcatcgactggatccatgtagattccaaaatgtgaaacttagattgtatatagaatgcactgtgtgtgttgaaaatgggctcattattgtgatgttttcagatatattacatatgccaaagaagaagaggccatcaggtgtattcaagctgtacacaattttgttttggaagggaaagtgttaaggtcaccctctatgctttgtagccttattgcagcagttttttttacataacgcagttagcctaatcgttaatggtttgttgcagagcgtgctttggtactacaaagtattgccatgcatggctgcggaacatggtatactcgttgcttcatcctggcagctttatttaccattactctacctactgccatccttctgagggcttttatcttctcttttttagacctgtggaaatccagattgtctctatttacatgatgtaggaagccaggaagatagtttcactaaagatgagataatctcagcatatacaaggtaagctgagctcgttgaacatatgtgtggaaagttccactgttccttattatggcactgtgccagtcctagccatatgtactttttcccctgccaagcctactgctactgttactatataatgctcttctgttctgagaatttgtagtctatcaacttttccctatactatgcatgaattattatgctttgctaaatgctaagattttcagtagttctgattggtgctttcgactcatcatctctcgttcctacaggagtagggttccccaaatggcgtctaatgtttctcaaagacgcgcagggactgtattacctcctccagcagaagatttctcatatagtgcagtggttgcagctaaacatccaatcaagaatggaataactgtatgttttttatactgaaaaatccattgggacactggacatgttcatttctgtttgatttcatgctgctacattaactggtcttattttgtacagaatactgcaaatcaatccaggctttcgcctccaaacagtagttctgggagatccacacttccaccagctgcttcatggtatgatgctgcttagggtctcatgatatgttttaaaatgtgaatttgttgctaaaatttttttggtatgagcagggggcatcgcgatttgaataccaggacaacagcaactggggtggcatcgtcacaatctcttactaaatcaaaagcagatcctcaaagtaattcattctcgagttcttcgactgtttcaagtacaaaactaccttcttcatggaatgatgacacaagcacagttccgaaaatgacggaaggacgagatagtttgtctaaaaccttgaagccatataagcctggtattgcaaaggaaacccaagctgtaacatcactggagtcatcgcttgacatagacttctctaccataccttcagcttggaacgatgatgatgtcacatcagatggcatgtcaaaaggaagtgacgagaagcaggttgtaaatgacaatggaaagtttgaatgttcagtttcttcaaagccagctgaatcagggcatcttacatcgaagtcaacgacatcaccaaagaaagacatcgcagtaaacagtaccaggcaaagtcctctaaattgtgtatcaagtccatcggtttctaaatcagaagtaaaggatggtgatggtgattaccaagtaaccaacatggcttctaaaacatctactttggtaattagaaaggaccaatctaatcaagcagctattgacacagcaaccgaagatactagatctgagagcacggatattgataggctttctgttggagtatcttcagtaacattaagcagaaaagatggggttcaaagtattgccgaaaaccaacaaccggatgcaatcctaagtacttcagttgtggtgccctttagtcagaatttgaaacttgctgagtgtaatgattctacatgtcagcctagttcagataagcatcgtgattggtgttcagatatccagagtagtgtgtctcctcagttaaatgacatagaaagttatgcagtagccactgataaatctcatggtagagtgctggatgctgctgatcaagcttcgtcttcaccatatgtccatttccctaacactgctcctatttcactgtggaatggtaaagagattaaccatacatcaacaagtgatagaacttccacaatgatgcaacctgggctgttatcttcagttgacagcacttctaccatgttaaatggacatcaagaagggctagggactatatatgcacctggtaaggtttctgaacatcctagaatgaaaaaccatcagcctggagcagttggtgcagtgagaattgataacataggcagttttgacaaggctgtaagtgtaaataaggatgagagcagcataattgctgatattttgtctttggagtttgatccatgggatgagtcgtattcaacggctaacaattttgctaagatgcttagtgcatctgaaaagaacgatgtgctttttgatgcacgttcatggaaaacaaaaaccagcaatagtgagtctagattttcatttgctagacaagataatcaaggaagcctcctagattcatctatgagaaattataaaagtgagcagaatttcagtttgccatcccagaattctcatggaaacatttatcagagtggcattgcatttcaatctcctgaggaaggtttctcaaagagcaactctcttactatgttggatatgctagctaccggtgagtagtatgaagttatattacgctgcttgtttattaaattcttaatgaacagtgagatgcagtactgcagttaatgtttttattttaatatttattttatatatttgaggtaatattaatgtgtcacaaaacaaatagatatattcgctaggatacagaagggatccaatgtttgtgcacccattcccctcttttaattcaatgttggcaatcttgtaacatatgtgattgggttgtggagctattaagtataaaatgcactgtgtttttatgttgaagcattttagtaactgatgttttcaccatggtacttctatgtacttacaaaaaaaatgctttttcaggcacatcaaagcctaaagtatccgcgcctcctggattttcagcaccagcaagagttcctactgggttttcttctggattttcatcccatgaggggttgaatccacctccaggattttcatctcataatgggcctaatccccctcctggattttcttctcagggtgggtctaatcagatctatggttcggcatactcaggttctctctctctctgcttctcctaaaacaatttcagtttctaataagtttgcaatgttttgcagaaactcgcccatttgatgatcttttgggtataaatactagccattatcaaccacagttagctagacaaacaagtgatatagaatttgttgatcctgctatattggctgtgggtaaagggcggatgcctggaataagtgattcagggttggagatgaaaacttcccatacttttccttcgcagttgcaaacatcaaatgatccaaggtttcaattacttatgcagcagaacatgccttcccatcaaaatgttggatttgcagaacatgttcaagatgcattcaaccctatgaatgataattatcttgcatcccgacttatacctcagaaccatggttctctatcctcttacacacagatgtcactccaacaacctagaagctcacatcttacaaatggtcattgggatggctggggtgatttgagacaagggaataatgtttccatgcctgacatgtcaaggatgttatatccaactgaagcaaacaacttccacatgctgggttcaaatgatctgtataacagagcttttggactgtgattatctttgggagatgcgacttgacctatcacccagctaacttgcacatttctcagttcttgaaattgattggttgcacaggctcaacttggtgattgttgagcttgtggattggcgcatgagtgtttattgaaaggcattggattcaagtggaccagcatgaaactgggtgtgtaaccagacgtttcaagcaccaggtttgtgtttcaccattctattcacatctttttttactatattatatgcatggcttgctaccccttgtcctggataggtggtgtgagttatcttcttattgcattggttagtactgtttgtgcttggtctcttccattttattctggaatttgttgctgtgtttgttctggaatttgctggcaagttactcaccatttgcctcgtttggtcatcaggttctgttttgggcgaaaggatatatatatcaaagatgcatccatgaggttgtccttcaagtttatatatacttgtggtggaagcagactcgagaatatataaaccgtttagcatttgcttctttcttctttttttgccgtcatgtggaaatattttcttggttttggcatagtaaaagcgtcattttgtacatgatacgttactcgttgctagtagcttttgtggtgcacatgagattattttgttgatgggtttgctgaaccaaacgtaaatggctatatggtaccaggccagccagcttatgctgaattgggtgttgtttggtgttgaatcaaaaacaaggtcgaggagtacttcggtgtgctgttgttaataatatcaattcatgac</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0102400, RefSeq:Os12g0102400

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named Jung