Difference between revisions of "Os01g0182600"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
*''OsGI'',a GI ortholog, regulates flowering time in response to photoperiodic conditions. Mutations in this gene delay flowering in inductive SDs (short-days),whereas flowering is marginally induced under LDs(long-days).In comparison, over expression of OsGI in transgenic rice causes late flowering in both SDs and LDs.In addition, OsGI has function to regulate Hd1, a gene that also shows circadian rhythm [1]. Os-GI affects gene expression of approximately 75% of genes among 27,201 genes and is required for strong amplitudes and proper phase-setting of  global gene expression under natural field conditions[2]. The cDNA of OsGI firstly found in se5 mutant that is completely photoperiod-insensitive, the expression patterns of rice and Arabidopsis GI gene are both photoperiodically regulated and are very similar under LD and SD conditions(FIG1)[3]. GI is required for phase-dependent CO transcription through the interaction with FKF1, which leads to cycling DNA binding with one finger (CDF) degradation and consequent derepression of CO. In addition, it has been known that GI protein interacts with ZEITLUPE (ZTL) F-box protein to control the diurnal rhythm of TOC1 protein in regulation of the Arabidopsis circadian clock[4]. Os-GI also has function to maintain bioactive GA level through the regulation of the GA-deactivating enzyme genes in rice, Os-GI represses major  
+
*''OsGI'',a ''GI'' ortholog, regulates flowering time in response to photoperiodic conditions. Mutations in this gene delay flowering in inductive SDs (short-days),whereas flowering is marginally induced under LDs(long-days).In comparison, over expression of ''OsGI'' in transgenic rice causes late flowering in both SDs and LDs.In addition, ''OsGI'' has function to regulate ''Hd1'', a gene that also shows circadian rhythm<ref name="ref1" />. ''Os-GI'' affects gene expression of approximately 75% of genes among 27,201 genes and is required for strong amplitudes and proper phase-setting of  global gene expression under natural field conditions<ref name="ref2" />.  
OsGA2ox genes in order to maintain a proper bioactive GA level, osgi-1 plants showed a semi-dwarf phenotype with elevated OsGA2ox gene expression(FIG2) [4].
+
*The cDNA of ''OsGI'' firstly found in ''se5'' mutant that is completely photoperiod-insensitive, the expression patterns of rice and Arabidopsis ''GI'' gene are both photoperiodically regulated and are very similar under LD and SD conditions(FIG1)<ref name="ref3" />. ''GI'' is required for phase-dependent ''CO'' transcription through the interaction with FKF1, which leads to cycling DNA binding with one finger (CDF) degradation and consequent derepression of CO. In addition, it has been known that GI protein interacts with ZEITLUPE (ZTL) F-box protein to control the diurnal rhythm of TOC1 protein in regulation of the Arabidopsis circadian clock<ref name="ref4" />.  
 +
*''Os-GI'' also has function to maintain bioactive GA level through the regulation of the GA-deactivating enzyme genes in rice, ''Os-GI'' represses major  
 +
''OsGA2ox'' genes in order to maintain a proper bioactive GA level, ''osgi-1'' plants showed a semi-dwarf phenotype with elevated ''OsGA2ox'' gene expression(FIG2) [4].
  
 
===Expression===
 
===Expression===

Revision as of 13:57, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

  • OsGI,a GI ortholog, regulates flowering time in response to photoperiodic conditions. Mutations in this gene delay flowering in inductive SDs (short-days),whereas flowering is marginally induced under LDs(long-days).In comparison, over expression of OsGI in transgenic rice causes late flowering in both SDs and LDs.In addition, OsGI has function to regulate Hd1, a gene that also shows circadian rhythm[1]. Os-GI affects gene expression of approximately 75% of genes among 27,201 genes and is required for strong amplitudes and proper phase-setting of global gene expression under natural field conditions[2].
  • The cDNA of OsGI firstly found in se5 mutant that is completely photoperiod-insensitive, the expression patterns of rice and Arabidopsis GI gene are both photoperiodically regulated and are very similar under LD and SD conditions(FIG1)[3]. GI is required for phase-dependent CO transcription through the interaction with FKF1, which leads to cycling DNA binding with one finger (CDF) degradation and consequent derepression of CO. In addition, it has been known that GI protein interacts with ZEITLUPE (ZTL) F-box protein to control the diurnal rhythm of TOC1 protein in regulation of the Arabidopsis circadian clock[4].
  • Os-GI also has function to maintain bioactive GA level through the regulation of the GA-deactivating enzyme genes in rice, Os-GI represses major

OsGA2ox genes in order to maintain a proper bioactive GA level, osgi-1 plants showed a semi-dwarf phenotype with elevated OsGA2ox gene expression(FIG2) [4].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

  • there is some evolutionary conservation between rice circadian clock–related genes and those associated with Arabidopsis circadian clocks,where the circadian clock consists of interlocked subloops, it is also possible that Os-GI is a member of a subloop in rice circadian clocks

Labs working on this gene

Please input related labs here.

Knowledge Extension

References

Please input cited references here.


Structured Information

Gene Name

Os01g0182600

Description

GIGANTEA protein

Version

NM_001048755.1 GI:115434923 GeneID:4325329

Length

9083 bp

Definition

Oryza sativa Japonica Group Os01g0182600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:4328362..4337444

Sequence Coding Region

4328725..4329030,4329123..4329215,4329333..4329551,4329752..4329820,4329925..4331421
,4332220..4332429,4332563..4332713,4332791..4333031,4333898..4333956
,4334379..4334653,4334813..4334955,4335034..4335088,4335181..4335258
,4335351..4335437

Expression

GEO Profiles:Os01g0182600

Genome Context

<gbrowseImage1> name=NC_008394:4328362..4337444 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:4328362..4337444 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcagcttcaaatgagaagtggattgatgggctccagttctcatcactgttctggcccccaccacaggattcacaacaaaaacaggcacaaattctggcctatgttgagtactttggccagtttacagctgacagtgagcaattccctgaagatatagctcagctaattcaaagttgctatccatcaaaagaaaagcgccttgtagatgaagtattagcaacttttgttcttcatcatcctgagcatggccatgcagttgtgcatccgattctgtcacgcatcatagatgggacactcagttatgatagaaatggtttcccgttcatgtccttcatctctttatttagccatacttctgagaaagagtactcggagcagtgggccttggcctgtggagaaattcttagagttctaactcactacaacaggccaatcttcaaagttgatcaccaacatagtgaagcggaatgtagcagcacatctgatcaggcctcatcatgtgagtctatggagaaaagggctaacggttctccaagaaatgaacctgaccggaagccattgaggccactatctccttggatcacagacatattgcttgctgcacctctgggtattagaagtgactattttagatggtgtggtggagtcatgggaaaatacgcagctggtggagaattgaagcctccaacaactgcttacagccgaggatctgggaagcacccacaacttatgccatccacgcccagatgggctgttgccaatggagctggagttatactaagtgtctgtgatgaggaagtagctcgttatgagacagcaaatttgactgcggcagctgttcctgcacttctattacctccaccgaccacaccattggacgaacatttggttgcggggctccctcctcttgaaccatatgctcgcttgtttcatagatactatgcaattgctactccaagtgctacccaaaggttgctttttggtcttctcgaggcaccaccatcatgggccccagatgcacttgatgcagcagtacagcttgttgaactccttagagcagcggaagattacgattctggcatgcggcttccaaagaactggatgcatcttcatttcctgcgtgctattggaactgcaatgtcaatgagagctggtatcgctgctgatacgtctgctgctttacttttccgaatactctcccaaccgacattactttttcctccactgagacatgccgaaggagttgaactccatcatgagccactaggtggctatgtatcatcgtacaaaaggcagctggaagttcctgcatctgaagccactattgatgccactgcgcaaggcattgcttccatgctatgtgctcatggtcccgatgttgagtggagaatatgtaccatctgggaggctgcgtatggtttgctacctctgagttcatcagcagttgatttgcctgaaattgttgtagctgctccacttcagccacctactttgtcatggagcctatacttgccattgttgaaagtatttgagtatttacctcgtgggagtccatctgaagcatgccttatgagaatttttgtggcaacagttgaagctatactgagaagaacttttccatcagaaacctctgaacaatccaggaaaccaagaagtcaatctaagaaccttgctgttgctgaactccgaacaatgatacattcactctttgtggagtcctgtgcttcaatggaccttgcgtccagattactatttgtagtattaactgtttgcgtcagtcatcaagctttgcctgggggaagtaaaaggccaactggtagtgataatcattcctctgaggaggtcacaaatgattcgagattaaccaatggaagaaacagatgtaagaagagacaaggaccagttgctacattcgactcatacgttctagcagccgtttgtgccttatcttgtgagctccagctgttcccttttatttccaagaatgggaaccattcaaatctgaaggactccataaagatagtcatacctggaaaaaccactggtatcagtaacgagctacacaatagcattagctcagcgattcttcatactcgtagaatacttggcatcttggaagctctgttctccttgaagccatcatctgttggtacttcatggagttatagttcaaatgagattgttgcagcagctatggttgctgctcatgtttctgagttatttcgtcgatccaggccatgcttaaatgcactgtctgcgctgaagcaatgcaagtgggatgctgagatttctaccagggcatcatccctttaccatttgattgacttgcatggtaaaacagtgacctccattgtgaacaaagctgagcctctagaagctcacctgacccttacaccagtaaaaaaggatgaacctcccattgaggaaaagaacattaactcatcagatggtggtgcattggaaaaaaaggatgcttcaagatcacacaggaaaaatggttttgcaagaccactcttgaaatgtgcagaagatgttatactaaatggtgatgtcgcaagtacttctgggaaagccattgcaagtttacaggtggaagcttctgatttggcaaacttcctcaccatggaccgaaatgggggttacagaggttctcaaactctcctaagatctgtactgtcagagaagcaggagctatgcttctctgttgtctcattgctctggcagaagctcattgcatctcccgaaatgcagatgtctgcagaaagtacatcagctcatcagggttggagaaaggttgtggatgcgctttgtgacattgtttcagcctcaccgaccaaggcttcagctgctatcgttctgcaggccgagaaggacttgcagccctggattgctcgagatgatgagcaaggtcagaagatgtggagagtcaaccagcgaatagttaagctgatagcagagcttatgaggaaccacgatagcccagaagcattggtgatccttgctagtgcttcagatcttcttcttcgagcaactgatggaatgcttgttgatggtgaagcttgtactttaccacaattagagctattggaagtaaccgccagagcagtccatctcatcgtcgaatggggagattcaggtgtatccgtcgctgatggcctctccaatctgctgaagtgccgtctatcaaccaccatccgctgtctttcgcaccccagcgcgcatgtccgtgcactcagcatgtccgtccttcgcgacatcttgaacagcggacaaataaactccagtaagctcatccaaggggaacaccggaatggcatccagagcccaacctaccagtgcttggcagcaagcatcatcaactggcaagccgatgtggagagatgcatagagtgggaagcccacagccgccgcgccaccgggctgacgctcgccttcctcaccgcggcggcgaaggagctcggctgcccactcacttgctga</cdnaseq>

Protein Sequence

<aaseq>MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTA DSEQFPEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSY DRNGFPFMSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSS TSDQASSCESMEKRANGSPRNEPDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVM GKYAAGGELKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGVILSVCDEEVARYETANL TAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATPSATQRLLFGLLEAP PSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFLRAIGTAMSMRAGIAADTS AALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLEVPASEATIDATAQGI ASMLCAHGPDVEWRICTIWEAAYGLLPLSSSAVDLPEIVVAAPLQPPTLSWSLYLPLL KVFEYLPRGSPSEACLMRIFVATVEAILRRTFPSETSEQSRKPRSQSKNLAVAELRTM IHSLFVESCASMDLASRLLFVVLTVCVSHQALPGGSKRPTGSDNHSSEEVTNDSRLTN GRNRCKKRQGPVATFDSYVLAAVCALSCELQLFPFISKNGNHSNLKDSIKIVIPGKTT GISNELHNSISSAILHTRRILGILEALFSLKPSSVGTSWSYSSNEIVAAAMVAAHVSE LFRRSRPCLNALSALKQCKWDAEISTRASSLYHLIDLHGKTVTSIVNKAEPLEAHLTL TPVKKDEPPIEEKNINSSDGGALEKKDASRSHRKNGFARPLLKCAEDVILNGDVASTS GKAIASLQVEASDLANFLTMDRNGGYRGSQTLLRSVLSEKQELCFSVVSLLWQKLIAS PEMQMSAESTSAHQGWRKVVDALCDIVSASPTKASAAIVLQAEKDLQPWIARDDEQGQ KMWRVNQRIVKLIAELMRNHDSPEALVILASASDLLLRATDGMLVDGEACTLPQLELL EVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHPSAHVRALSMSVLRDIL NSGQINSSKLIQGEHRNGIQSPTYQCLAASIINWQADVERCIEWEAHSRRATGLTLAF LTAAAKELGCPLTC</aaseq>

Gene Sequence

<dnaseqindica>8415..8720#8230..8322#7894..8112#7625..7693#6024..7520#5016..5225#4732..4882#4414..4654#3489..3547#2792..3066#2490..2632#2357..2411#2187..2264#2008..2094#ccgagccgtttctctccctctctctctcctcctccttcccctgcgcctcctccaccgcccgtgtcgccgccgcgcgcgtctatcccctcgccgccgccgccgtctacgccgcgtgaggtccggattggttgaaaggctgatcgaggtaatgcttttttatttttcccgtgcggttttagtttttctgtgctgtgcttggtggttttttctttaaaactatttttaggctggttttgatgatggcctttctaaggttgtcgtgtatggggggcgaggtggttcgggtggatttgtggtgttatgttgaggggatttttgtttggggggagagagttttggtggtagatgcggttgggattttgaagacgtgaaagggaaattagttttgaaatttgacggcgaggttgagctgattagtattgtaataattcgtggcatcggatagatcaacgcgagatggatgcttattactgcgaatttcaggaggtttttgtggtttttttaggcgagtagcgttgattctagctggattttgctgcttcgtggaggcgtttagatgtggtgcatacggctgtggatgtaatttgtgcggggataattactgaaaattaattcgcagtaagctagctctgctttaatattttttcccctgaaacagtaacaagggatcccttcctcatttcgttaacagtggaagtgaatacagacaccaaccgatgagcagagacacctgtaattaaacaccaaaagaagaacctgttttgttcctatatattttccatttctatgctttaggtaatatactttctggttcggtgtcatagtacccgaaatagaatctttgcttgccaaaaaaagaaagaataacaagatagaacaacatcattaaattctgtcttagacaatacatttataatcgaccaacaaaaacagaccgatgagtgacgtggaataacaaatgaagtataaatgtcacgaaaaacacatctattgattttgtgtgataagccataggagcctacgaggaaccaagtgaatggttctgtacaccacatccattagcattaccataaatttgcctatttctatgatgccttccttaacatatttatcgacatgtgagcttgcaccataactaaatgttatggtaaactttaccttataaatgattgcaacatgtaccttttcatttcgataattaaaaacgagaaagcttccacctttttcctagatatattttttcgtttgattatgaatttagttgtacttgacaataaaataatgcgcttgtaagattatgcaattttcgttgcattacctccctctcttttcatttgtcagtttttttctactccctccgtttcatattttaagtcgtttgacttttttcctagtcagactttgttaagtttgacaaagtttatagtaaaatttagcaatatctaaaatattaaattggtttcatcaaatctaacattgaatatattttgataatatgttttttttgtgttgaaaatacttctatatttttctataaacttagtcaaacttggaagaaatttcagtaagaaaaaagtcaaacggcttataatatgaaacggagggagtaaatttttttttgcattaattaaaattcatgtattttcctccttttttggtttttgttgtgcgatatattacagtgtagagactctgaagctcatatggttggcattggttgatatgataacgtgtcacgttgtgagatgcagacccccgttatgggggttgattgaatgaagtggatagcactcttataactttcttgctcgaagtttcttgataccaaggcaagtagcttataagaagatttggactttggtggcataaatggatgaactaactggcggcttcaacgtggtgttgattacaggtgcttttattgctaactggagcagtttgtgtagtttctttctttctctttgagaattctctcagtttcttgggcaggctcttgagctaccaagtatgtcagcttcaaatgagaagtggattgatgggctccagttctcatcactgttctggcccccaccacaggattcacaacaaaaacaggtaacattattcctatttgattcttgttagaaattctatatgttgaacatacttgcctcaatgggaaacttggttgcgtctcctctctgaaggcacaaattctggcctatgttgagtactttggccagtttacagctgacagtgagcaattccctgaagatatagctcaggtactgtatctctaagcatgtttagtatcttctgtgataaaatctttctccagtgtgttaacttttgcattctttttcttgcatgcttgcagctaattcaaagttgctatccatcaaaagaaaagcgccttgtagatgaagtattaggtaatttgatccagtgatcaatacatgttccacaaacaattgaagaaagagtttgacatatttttctcatatttccagcaacttttgttcttcatcatcctgagcatggccatgcagttgtgcatccgattctgtcacgcatcatagatgggacactcagttatgatagaaatggtttcccgttcatgtccttcatctctttatttagccatacttctgaggtaaggcccctactctaatggttagttccaatttattggttcatttctctgtgtttgataagattttgcctctgctgtgcatttcaatattatatctaaactgtgctgcttatagcttatcaaactactcttgctcataaagatgcaacttttatgcagaaagagtactcggagcagtgggccttggcctgtggagaaattcttagagttctaactcactacaacaggccaatcttcaaagttgatcaccaacatagtgaagcggaatgtagcagcacatctgatcaggcctcatcatgtgagtctatggagaaaagggctaacggttctccaagaaatgaacctgaccggaagccattgaggccactatctccttggatcacagacatattgcttgctgcacctctgggtattagaagtgactattttagatggtgagtcataataaatgataacatattattgttctgtggactgaaaatctgaaatcctcctttcttgagaaatacaacctcaattttatggtgatattgacaagaaggaagagcgcatataatttaaagttaaaacacggaaaataatagaagtatgtgagcagaacgcaggagcaaggggtggaactcataacaagttcaaacttcatgcatgttcataattccccaatgcaagtatggcaagaaaaatagacaacttttaaaagtatgctaatggaactgcatgcattgtgtaaacttgcttttgtcaagcatgttggaacatactatatatttgctgctgatgatgaaaaatttgcttgagtactcttctattgctaatggacgcttaccattccctgttttgtcttcaaatgcatcaggtgtggtggagtcatgggaaaatacgcagctggtggagaattgaagcctccaacaactggttggtaaaatcagcaatggaattttctatcgtgaattttttataattattgtaacattaattactcccatgtctttttattctgttgagataccatgtgacaatgtctacaattgcatattttgcattctttggtagatcagttcccttcttaagatccccaaagggaaactggagtatcaataacttactccctcaaataaaaaaaaagtgatactttaggcataaacacattcttcaaaacaaaactttgaatagcagtttcttttgtaatatattaataaagcatggaaaaattataatgtgaagaatgtacattcagggacaaatatactcatcatttttgcatggttgatcttaatgtccatagagagattgatcagaccaaaagtttatttttgacaggagtgagtatggattataataggagtgaatggcaatatgctgtgaaagtgagcattttatatttgtttactactagcatttggtgacaaagcaaatgatgtatattgtaaatcaaagtaaacaagtagaacatgtcctgtggcgacaagacataacctacaaattaaagttagcctgattgtttattttactgggagcacattttttctagattctagagtacatattattaaaaaaggtgtgatatgtttgcaaattactttttaatggaagtttgtaaattactttgaaacttgcattcagtttttttgcttcttaaaaaacatagtgcatatgggctttatgagctcatactatgcatgtttttctgcattggagtgggacctttatctttttcttgcaactcggatgctaatgcttattataaacacaagttactaacatgtgcttgggtcattcagcttacagccgaggatctgggaagcacccacaacttatgccatccacgcccagatgggctgttgccaatggagctggagttatactaagtgtctgtgatgaggaagtagctcgttatgagacagcaaatttgactgcggcagctgttcctgcacttctattacctccaccgaccacaccattggacgaacatttggttgcggggctccctcctcttgaaccatatgctcgcttgtttcataggtaagctcttatgatcctgtccactgttgtaccatgtgtactttccaaatgattgctaacatgctatttttcgtcagatactatgcaattgctactccaagtgctacccaaaggttgctttttggtcttctcgaggcaccaccatcatgggccccagatgcacttgatgcagcagtacagcttgttgaactccttagagcagcggaagattacgattctggcatgcgggtatatcatacatctctctggctgttgtttcagtgctatcaatcaagatgacacatcatgcaatattatcataacagcacattatgtgttttgaatattttattgattgtcatagctttgttttatgttttagcttccaaagaactggatgcatcttcatttcctgcgtgctattggaactgcaatgtcaatgagagctggtatcgctgctgatacgtctgctgctttacttttccgaatactctcccaaccgacattactttttcctccactgagacatgccgaaggagttgaactccatcatgagccactaggtggctatgtatcatcgtacaaaaggcaggtatgcagtgtttcctgcacctacttgctacctattctgtatttgatgtattcaatttcctttttatcagttttctcgaaatatatgctaataggcttgtcactaaacggctacattatccagactctgttctgaatttttttttcattaagtactgttagctgccagattacatcatcatgactaaagtagtttagctacaatattgcaaagctagatttgtctagcctctattgttttgaatagaaaaggcaggtatgcagtgtttcctgcacctacttgctacctattctgtatttgatgtattcaatttcctttttatcagttttctcgaaatatatgctaataggcttgtcactaaacggctacattatccagactctgttctgaatttttttttcattaagtactgttagctgccagattacatcatcatgactaaagtagtttagctacaatattgcaaagctagatttgtctagcctctattgttttgaatagaaaattaaatcttttggtcatttttttgtaaccttttaggagtctctgtatgcttgtcgtcaacatgctatgataagtttatatcagttcttttggagctatgatgtattcttgtatattttatgactgctaggatattatgttaaaactgttttaaaggtatcatcaaacaagttaatatagatattgctacctaccaaagttggaatttgattatgtcgtaaaatatatgcaccctacatgttttagcttcatattgacttatattttcatatgtgctccttcaactgcacaaagctggaagttcctgcatctgaagccactattgatgccactgcgcaaggcattgcttccatgctatgtgctcatggtcccgatgttgagtggagaatatgtaccatctgggaggctgcgtatggtttgctacctctgagttcatcagcagttgatttgcctgaaattgttgtagctgctccacttcagccacctactttgtcatggagcctatacttgccattgttgaaagtatttgagtatttacctcgtgggagtccatctgaagcatgccttatgagaatttttgtggcaacagttgaagctatactgagaagaacttttccatcagaaacctctgaacaatccaggaaaccaagaagtcaatctaagaaccttgctgttgctgaactccgaacaatgatacattcactctttgtggagtcctgtgcttcaatggaccttgcgtccagattactatttgtagtattaactgtttgcgtcagtcatcaagctttgcctgggggaagtaaaaggccaactggtagtgataatcattcctctgaggaggtcacaaatgattcgagattaaccaatggaagaaacagatgtaagaagagacaaggaccagttgctacattcgactcatacgttctagcagccgtttgtgccttatcttgtgagctccagctgttcccttttatttccaagaatgggaaccattcaaatctgaaggactccataaagatagtcatacctggaaaaaccactggtatcagtaacgagctacacaatagcattagctcagcgattcttcatactcgtagaatacttggcatcttggaagctctgttctccttgaagccatcatctgttggtacttcatggagttatagttcaaatgagattgttgcagcagctatggttgctgctcatgtttctgagttatttcgtcgatccaggccatgcttaaatgcactgtctgcgctgaagcaatgcaagtgggatgctgagatttctaccagggcatcatccctttaccatttgattgacttgcatggtaaaacagtgacctccattgtgaacaaagctgagcctctagaagctcacctgacccttacaccagtaaaaaaggatgaacctcccattgaggaaaagaacattaactcatcagatggtggtgcattggaaaaaaaggatgcttcaagatcacacaggaaaaatggttttgcaagaccactcttgaaatgtgcagaagatgttatactaaatggtgatgtcgcaagtacttctgggaaagccattgcaagtttacaggtggaagcttctgatttggcaaacttcctcaccatggaccgaaatgggggttacagaggttctcaaactctcctaagatctgtactgtcagagaagcaggagctatgcttctctgttgtctcattgctctggcagaagctcattgcatctcccgaaatgcagatgtctgcagaaagtacatcagctcatcagggttggagaaaggtatggtcattcctgcttataagataccagaataatgctatgaagaccgtccttggttgtcagcattcttatacacaatgataatctttgtttttcatgggtaggttgtggatgcgctttgtgacattgtttcagcctcaccgaccaaggcttcagctgctatcgttctgcaggtcaagatattgttattgttatatttacatacttgttatcatatttaaaagcttcatattgtatgtacctttgaaaaaaaaagttccatactgtagcttcttttgttctcatttcttggtttcaaagcatcagcatcattaccgatataaaatatacccatttcctcagtcatcttccccgactcttgtatctttcacaggccgagaaggacttgcagccctggattgctcgagatgatgagcaaggtcagaagatgtggagagtcaaccagcgaatagttaagctgatagcagagcttatgaggaaccacgatagcccagaagcattggtgatccttgctagtgcttcagatcttcttcttcgagcaactgatggaatgcttgttgatggtgaagcttgtactttaccacaattagaggtaacaccttcattcatgaggtccttaggtgcaaatcccagtgaagaataatcagttctactttgtatggttcatctcgcttactgaccggttcatctcgggatcaattacgagcagctattggaagtaaccgccagagcagtccatctcatcgtcgaatggggagattcaggtgtatccgtcgctgatggcctctccaatctgctgaaggcatgtcctcttctctgatctcactcacgttcatgccaaacttactcatcatcatccatgatccatcatcctgactgaatcttgatatgcagtgccgtctatcaaccaccatccgctgtctttcgcaccccagcgcgcatgtccgtgcactcagcatgtccgtccttcgcgacatcttgaacagcggacaaataaactccagtaagctcatccaaggggaacaccggaatggcatccagagcccaacctaccagtgcttggcagcaagcatcatcaactggcaagccgatgtggagagatgcatagagtgggaagcccacagccgccgcgccaccgggctgacgctcgccttcctcaccgcggcggcgaaggagctcggctgcccactcacttgctgacaaggccacaccatgactgtcactgcaagcagctgctgtaggatcagcgagtaggaaaggatgacttgccggccagtttcctgagatgtgatttaagactgatattagctgatgttcccaagcatgatacggggcttgctcccaagatgtgatttttactttacttttggttaatgtgctaccgctgacattagatgttcaagcatatgaaaactgcttgtgctgtaacttgtatgtctgtaacgtaaaaatctttccatatggtaaccggggaagcagaggtatatccttttctgctgttgtatctatttccagtttcctgctgaacttgcaaatgaatattcagcaatttccgttttgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0182600, RefSeq:Os01g0182600

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4