Difference between revisions of "Os03g0742900"
Leilei Yang (talk | contribs) (→Expression) |
Leilei Yang (talk | contribs) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ||
| + | The gene ''Os03g0742900'' (''Oryza sativa indoleacetic acid 13(OsIAA13)'') is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1]. | ||
| + | |||
| + | A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1]. | ||
[[File:Figure 1.JPG]] | [[File:Figure 1.JPG]] | ||
| Line 11: | Line 14: | ||
===Expression=== | ===Expression=== | ||
| − | + | Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in Osiaa13. | |
| + | |||
| Line 17: | Line 21: | ||
===Evolution=== | ===Evolution=== | ||
| − | + | OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation. | |
| − | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan | |
==References== | ==References== | ||
| − | + | 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122 | |
| − | + | 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59. | |
| + | 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168. | ||
| + | 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463. | ||
| + | 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130 | ||
| + | 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161. | ||
==Structured Information== | ==Structured Information== | ||
{{JaponicaGene| | {{JaponicaGene| | ||
Revision as of 01:56, 11 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The gene Os03g0742900 (Oryza sativa indoleacetic acid 13(OsIAA13)) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].
A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13[1].
Expression
Comparison of the expression levels of candidate genes between wild-type and Osiaa13 plants revealed that 7 genes are downregulated and 2 genes are upregulated in Osiaa13. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in Osiaa13.
Evolution
OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in Arabidopsis[2]. It has been reported that lateral root initiation is inhibited in a SLR/IAA14 gain-of-function mutant, and in ARF7 and ARF19 loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that OsIAA13, OsIAA11, and OsIAA30 show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, OsIAA13, OsIAA11, and OsIAA30 may play an important role in lateral root formation but not in crown root formation.
Labs working on this gene
Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan
References
1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (Oryza sativa), Functional and Integrative Genomics 6 (2006) 47–59. 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the SOLITARY-ROOT/IAA14 gene of Arabidopsis, Plant Journal 29 (2002) 153–168. 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: Unique and overlapping functions of ARF7 and ARF19, Plant Cell 17 (2005) 444–463. 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in OsIAA11 affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.
Structured Information
| Gene Name |
Os03g0742900 |
|---|---|
| Description |
Aux /IAA protein |
| Version |
NM_001057765.1 GI:115455258 GeneID:4334069 |
| Length |
2585 bp |
| Definition |
Oryza sativa Japonica Group Os03g0742900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:31243860..31246444 |
| Sequence Coding Region |
31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:31243860..31246444 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:31243860..31246444 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga</cdnaseq> |
| Protein Sequence |
<aaseq>MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS</aaseq> |
| Gene Sequence |
<dnaseqindica>2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt</dnaseqindica> |
| External Link(s) |
