Difference between revisions of "Os03g0742900"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 
The gene ''Os03g0742900'' (''Oryza sativa indoleacetic acid 13(OsIAA13)'') is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].
 
  
 
A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].
 
A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].
Line 14: Line 12:
  
 
===Expression===
 
===Expression===
Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in Osiaa13.
+
Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.
  
  
Line 29: Line 27:
 
==References==
 
==References==
 
1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122
 
1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122
 +
 
2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.
 
2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.
 +
 
3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.
 
3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.
 +
 
4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.
 
4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.
 +
 
5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130
 
5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130
 +
 
6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.
 
6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.
 +
 
==Structured Information==
 
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|

Revision as of 02:05, 11 June 2014

The gene Os03g0742900 which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].

Annotated Information

Function

A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13[1].

Figure 1.JPG


Figure 2.JPG

Expression

Comparison of the expression levels of candidate genes between wild-type and Osiaa13 plants revealed that 7 genes are downregulated and 2 genes are upregulated in Osiaa13. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in Osiaa13.


Figure 3.JPG

Evolution

OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in Arabidopsis[2]. It has been reported that lateral root initiation is inhibited in a SLR/IAA14 gain-of-function mutant, and in ARF7 and ARF19 loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that OsIAA13, OsIAA11, and OsIAA30 show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, OsIAA13, OsIAA11, and OsIAA30 may play an important role in lateral root formation but not in crown root formation.


Labs working on this gene

Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan

References

1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122

2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (Oryza sativa), Functional and Integrative Genomics 6 (2006) 47–59.

3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the SOLITARY-ROOT/IAA14 gene of Arabidopsis, Plant Journal 29 (2002) 153–168.

4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: Unique and overlapping functions of ARF7 and ARF19, Plant Cell 17 (2005) 444–463.

5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130

6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in OsIAA11 affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.

Structured Information

Gene Name

Os03g0742900

Description

Aux /IAA protein

Version

NM_001057765.1 GI:115455258 GeneID:4334069

Length

2585 bp

Definition

Oryza sativa Japonica Group Os03g0742900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:31243860..31246444

Sequence Coding Region

31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287

Expression

GEO Profiles:Os03g0742900

Genome Context

<gbrowseImage1> name=NC_008396:31243860..31246444 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:31243860..31246444 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga</cdnaseq>

Protein Sequence

<aaseq>MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS</aaseq>

Gene Sequence

<dnaseqindica>2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0742900, RefSeq:Os03g0742900