Difference between revisions of "Os01g0248900"
(→References) |
(→Expression) |
||
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | + | Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. | |
| + | [[Os01g0248900_protein_3D_structure.png]] | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 11:49, 11 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. Os01g0248900_protein_3D_structure.png
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.
2. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.
3. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.
4. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.
Structured Information
| Gene Name |
Os01g0248900 |
|---|---|
| Description |
Similar to Expansin Os-EXPA3 |
| Version |
NM_001049122.1 GI:115435657 GeneID:4327217 |
| Length |
1014 bp |
| Definition |
Oryza sativa Japonica Group Os01g0248900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:8195063..8196076 |
| Sequence Coding Region |
8195191..8195819,8195941..8196067 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:8195063..8196076 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:8195063..8196076 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY</aaseq> |
| Gene Sequence |
<dnaseqindica>258..886#10..136#gacgcgacaatggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggttagtagcaaattaagctcagctaatcaccatgcatgtgttaattaatcttttgcaaagtttaattggcatttacaataatggagtttggtctctctctcgtctcgtgtgtgatatccaggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactgatgagcattaattgcaagcctatctcatttaattaatctggaccgttcgatgtagtatattgtatgctttgatcgacgtggcataggatggaagaggccgcccacgaagaaaatttgggacttgtgtat</dnaseqindica> |
| External Link(s) |