Difference between revisions of "Os04g0488700"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
OsPti1a, a functional ortholog of tomato SlPti1, negatively regulates both basal resistance and R-gene-mediated resistance in rice. To investigate the molecular function of OsPti1a in defense responses, we searched for components interacting with OsPti1a using a yeast two-hybrid system. One of the interacting proteins is a Ser/Thr kinase that directly phosphorylates OsPti1a in vitro. This protein belongs to the AGC kinase family and is highly similar to AtOxi1, which is induced in response to a wide range of reactive oxygen species (ROS)-generating stimuli in Arabidopsis. Thus, it was designated OsOxi1. OsOxi1 was transiently phosphorylated in response to ROS and chitin elicitor. Both OsOxi1-overexpressing transgenic lines and the ospti1a mutant were highly sensitive to ROS treatment, indicating that OsOxi1 and OsPti1a are involved in ROS-mediated signaling in opposing ways.<ref name="ref1" />The AGC kinase OsOxi1, which has been isolated as an interactor with OsPti1a, positively regulates basal disease resistance in rice. In eukaryotes, AGC kinase family proteins are regulated by 3-phosphoinositide-dependent protein kinase 1 (Pdk1). In Arabidopsis, AtPdk1 directly interacts with phosphatidic acid, which functions as a second messenger in both biotic and abiotic stress responses.<ref name="ref2" />
  
 
===Expression===
 
===Expression===

Revision as of 10:08, 13 June 2014

The locus name of rice Os11g0523800 is AGC Kinase.Gene symbols are OsOxi1,Located on chromosome 4.

Annotated Information

Function

OsPti1a, a functional ortholog of tomato SlPti1, negatively regulates both basal resistance and R-gene-mediated resistance in rice. To investigate the molecular function of OsPti1a in defense responses, we searched for components interacting with OsPti1a using a yeast two-hybrid system. One of the interacting proteins is a Ser/Thr kinase that directly phosphorylates OsPti1a in vitro. This protein belongs to the AGC kinase family and is highly similar to AtOxi1, which is induced in response to a wide range of reactive oxygen species (ROS)-generating stimuli in Arabidopsis. Thus, it was designated OsOxi1. OsOxi1 was transiently phosphorylated in response to ROS and chitin elicitor. Both OsOxi1-overexpressing transgenic lines and the ospti1a mutant were highly sensitive to ROS treatment, indicating that OsOxi1 and OsPti1a are involved in ROS-mediated signaling in opposing ways.[1]The AGC kinase OsOxi1, which has been isolated as an interactor with OsPti1a, positively regulates basal disease resistance in rice. In eukaryotes, AGC kinase family proteins are regulated by 3-phosphoinositide-dependent protein kinase 1 (Pdk1). In Arabidopsis, AtPdk1 directly interacts with phosphatidic acid, which functions as a second messenger in both biotic and abiotic stress responses.[2]

Expression

Please input expression information here.

Evolution

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0488700

Description

Similar to PHY3

Version

NM_001059689.1 GI:115459107 GeneID:4336231

Length

2095 bp

Definition

Oryza sativa Japonica Group Os04g0488700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:24814867..24816961

Sequence Coding Region

24815352..24816330,24816444..24816853

Expression

GEO Profiles:Os04g0488700

Genome Context

<gbrowseImage1> name=NC_008397:24814867..24816961 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:24814867..24816961 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggcggcgatggcgccctcgcctccggagccggcgttgccgcgggagctcagcctgggggacctcagggcggtgtccatgctcggccggggcgccaagggcgtcgtgttccacgtcgtgcccgcggcggcgggggaggaggaggcctccatggcgctcaaggcggtctcgcgggaggcggcgcggcacaagaagaacgggagcggcggcgaggacgggcaccggcggatctggttcgagcgggacgtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtcctcgccaccgacgccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaactcgctccggcgccgccagaccgagaagatgttctccgactccgtcatccgcttctacgccgcggagttggtgctggcgctcgactatctgcacagcctcggcatcgtgtaccgcgacctcaagccggagaacgtcctgatacaggacagcggccacatcatgctcgtcgacttcgacctctccacgaggctcccgacgccgccgccgccaccggaggagcaggacgcaacgattgctgattccatgccggagcctccgcccagttcaccgtccccgaaccgcgcgaagggcaagaggcaaccgggggcggcctcgtgcttcccgttctgttcggtcggcgccacgaagccggccgcgtcggcggactcgccgtcgccaacgtccacctcgcgcacggcctcggcgtcgtcctcgtcctcatcctcgacggccaccaccgcgtcgtcctccaccgccgctggcgtgcggtcgccagcgaagtcgaactcgttcgtgggcacggaggactacgtggcgccggagatcatcgccggcagcgggcacgacttctccgtggactggtggggcctgggcgtggtgctctacgagatgctctacggccgcacgccgttccgggggctgaacaggaaggagacgttctaccgcgtcctctccaagcagccggagctcgtcggcgagaagacgccgctgcgcgacctcatcgcccgcctcctggagaaggaccccgagaagcgcatcggcgcgcgcgggatcaaggcgcacccgttcttcaacggcgtcgactgggaccgcatcctccgcgtggcgcgcccgccgttcatcccgcccccgccggaggacgaggacgaggccggcgaggtgctcgacgtcgagaaggtcgtcaacgaggtgttcgcggccaatgacggcggggccgcagcgggtgtggtggagaagccttcgccggaggcaggtggaactctggccgtcggcgatggcgagcagaggagagatccgtccaaagaaggcgatttctccgtatttttctga</cdnaseq>

Protein Sequence

<aaseq>MAAAAMAPSPPEPALPRELSLGDLRAVSMLGRGAKGVVFHVVPA AAGEEEASMALKAVSREAARHKKNGSGGEDGHRRIWFERDVLMSLRHPLLPSLRGVLA TDAVVGFAIDRCGGGDLNSLRRRQTEKMFSDSVIRFYAAELVLALDYLHSLGIVYRDL KPENVLIQDSGHIMLVDFDLSTRLPTPPPPPEEQDATIADSMPEPPPSSPSPNRAKGK RQPGAASCFPFCSVGATKPAASADSPSPTSTSRTASASSSSSSSTATTASSSTAAGVR SPAKSNSFVGTEDYVAPEIIAGSGHDFSVDWWGLGVVLYEMLYGRTPFRGLNRKETFY RVLSKQPELVGEKTPLRDLIARLLEKDPEKRIGARGIKAHPFFNGVDWDRILRVARPP FIPPPPEDEDEAGEVLDVEKVVNEVFAANDGGAAAGVVEKPSPEAGGTLAVGDGEQRR DPSKEGDFSVFF</aaseq>

Gene Sequence

<dnaseqindica>632..1610#109..518#tcgcgcaccgaccccactcggatcctctcctcccctcctcactgcctctctcccgtccacgagcggttggtcgatcgatcgatcgatcggcgcggtccttcgccagccatggcggcggcggcgatggcgccctcgcctccggagccggcgttgccgcgggagctcagcctgggggacctcagggcggtgtccatgctcggccggggcgccaagggcgtcgtgttccacgtcgtgcccgcggcggcgggggaggaggaggcctccatggcgctcaaggcggtctcgcgggaggcggcgcggcacaagaagaacgggagcggcggcgaggacgggcaccggcggatctggttcgagcgggacgtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtcctcgccaccgacgccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaactcgctccggcgccgccagaccgagaagatgttctccgactccgtcatccggtacgcttctcgcatcccccccgtttggccatcgccgcttctccgccacccacccgcgcacgaatgggttaactaaccacctcgccgttgttgattgttgcttctgattgcagcttctacgccgcggagttggtgctggcgctcgactatctgcacagcctcggcatcgtgtaccgcgacctcaagccggagaacgtcctgatacaggacagcggccacatcatgctcgtcgacttcgacctctccacgaggctcccgacgccgccgccgccaccggaggagcaggacgcaacgattgctgattccatgccggagcctccgcccagttcaccgtccccgaaccgcgcgaagggcaagaggcaaccgggggcggcctcgtgcttcccgttctgttcggtcggcgccacgaagccggccgcgtcggcggactcgccgtcgccaacgtccacctcgcgcacggcctcggcgtcgtcctcgtcctcatcctcgacggccaccaccgcgtcgtcctccaccgccgctggcgtgcggtcgccagcgaagtcgaactcgttcgtgggcacggaggactacgtggcgccggagatcatcgccggcagcgggcacgacttctccgtggactggtggggcctgggcgtggtgctctacgagatgctctacggccgcacgccgttccgggggctgaacaggaaggagacgttctaccgcgtcctctccaagcagccggagctcgtcggcgagaagacgccgctgcgcgacctcatcgcccgcctcctggagaaggaccccgagaagcgcatcggcgcgcgcgggatcaaggcgcacccgttcttcaacggcgtcgactgggaccgcatcctccgcgtggcgcgcccgccgttcatcccgcccccgccggaggacgaggacgaggccggcgaggtgctcgacgtcgagaaggtcgtcaacgaggtgttcgcggccaatgacggcggggccgcagcgggtgtggtggagaagccttcgccggaggcaggtggaactctggccgtcggcgatggcgagcagaggagagatccgtccaaagaaggcgatttctccgtatttttctgagcgtatttattgagttcttttttagcgttctctctcttaaaaatggaaaattacatagctattttggttttttctatggactagaattattatgggggtctctattagtaatagacataattaagacaaagtacggcgcggtggagtacataaatcgactttgctcttgtgtttaatggagtacagtctgtatagtatttttcccctttcccttttattttcttctttgttggatacatttccccgtgcaacgatgcaagctaggggattactgaagagtgtacataaggaatgatgaacagcaaaattggcctaatgttgtgtccatccatgtgttccatttcgctttgggtagccattgatgttaatacctgttacttcctttcagtgggagtaatagaaatggtcacggttttgtacatttttctgcaacattctctcaaagtagtaaatgctttgaagtgcccttgcgccatcaatgaggt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0488700, RefSeq:Os04g0488700

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2