Difference between revisions of "Os10g0471100"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
Wda1 is a male-sterile mutant of rice, wax-deficient anther1 (wda1), that was generated through T-DNA insertional mutation, and is preferentially expressed in epidermis of various floral organs, including Anthers. This mutant shows morphological changes in its pollen and anther walls as well as alterations in its wax composition. Wda1 encodes a protein with high similarity to proteins involved in wax production. Wda1 transcript is abundant during flowering stages.
+
Wda1 is strongly expressed in the epidermal cells of rice anthers. Wda1 transcript is abundant during flowering stages.Because the GUS gene located in T-DNA was fused to Wda1, the level and pattern of expression of the fusion gene could be assayed for GUS activity. Experiments have showed temporal and spatial expression patterns of the Wda1-GUS fusion product in heterozygous spikelets at various flowering stages(Fig.1). High levels of GUS activity were observed in spikelets from the premeiosis stage to the heading stage (Fig. 1A and 1K ). GUS activity was also prominent in the outer and inner epidermis (Fig. 1H) and trichomes (Fig. 1G) of the palea/lemma, lodicules (Fig. 1C, 1E, 1F, and 1I), stigmas (Fig. 1C), and anthers (Fig. 1C, 1D, 1I, and 1J). Cross sections of heterozygotic anthers at the vacuolated pollen stage revealed that GUS was expressed strongly in the epidermis but only weakly in the tapetum, endothecium, and connective tissue (Fig. 1J). In vegetative tissue, GUS activity was mostly absent except at collar regions (between the leaf sheath and the leaf blade) and the base of shoots. Semiquantitative RT-PCR analyses have been performed to examine whether GUS activity truly represented Wda1 expression patterns. Wda1 was highly expressed in panicles at various developmental stages (Fig. 1K) but only very weakly in the roots and shoots of 7-d-old seedlings. Only low transcript levels were detected in the developing seeds and flag leaves. In developing spikelets, transcript was detected in all floral organs (Fig. 1K and 1L), but it was barely detectable in the wda1 anthers (Fig. 1L). LOC_Os02g40780, which is the most similar rice gene to Wda1, was also expressed throughout panicle development. However, its expression was much higher in the shoots and flag leaves. In mature spikelets, transcript levels were low in the anthers and palea/lemma and barely detectable in the ovaries and lodicules (Fig. 1L). These results indicate that Wda1 functions primarily in the panicles, especially in the reproductive organs, whereas LOC_Os02g40780 may play roles in both vegetative and reproductive organs.
  
 
===Evolution===
 
===Evolution===

Revision as of 05:26, 14 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Wax-deficient anther1 (Wda1), a rice homolog of Arabidopsis CER1, is a male-sterile mutant of rice, that was generated through T-DNA insertional mutation, and is preferentially expressed in epidermis of various floral organs, including Anthers. This mutant shows morphological changes in its pollen and anther walls as well as alterations in its wax composition. Wda1 mutant shows defects in the biosynthesis of very-long-chain fatty acids in both layers of anthers. Scanning electron microscopy analysis shows that epicuticular wax crystals were absent in the outer layer of the anther and that microspore development was severely retarded and finally disrupted as a result of defective pollen exine formation in the mature anthers. Biochemical analysis of the wda1 mutant anthers showed that the levels of very-long-chain alkanes, alkens, fatty acids, and primary alchols are severely reduced.

Expression

Wda1 is strongly expressed in the epidermal cells of rice anthers. Wda1 transcript is abundant during flowering stages.Because the GUS gene located in T-DNA was fused to Wda1, the level and pattern of expression of the fusion gene could be assayed for GUS activity. Experiments have showed temporal and spatial expression patterns of the Wda1-GUS fusion product in heterozygous spikelets at various flowering stages(Fig.1). High levels of GUS activity were observed in spikelets from the premeiosis stage to the heading stage (Fig. 1A and 1K ). GUS activity was also prominent in the outer and inner epidermis (Fig. 1H) and trichomes (Fig. 1G) of the palea/lemma, lodicules (Fig. 1C, 1E, 1F, and 1I), stigmas (Fig. 1C), and anthers (Fig. 1C, 1D, 1I, and 1J). Cross sections of heterozygotic anthers at the vacuolated pollen stage revealed that GUS was expressed strongly in the epidermis but only weakly in the tapetum, endothecium, and connective tissue (Fig. 1J). In vegetative tissue, GUS activity was mostly absent except at collar regions (between the leaf sheath and the leaf blade) and the base of shoots. Semiquantitative RT-PCR analyses have been performed to examine whether GUS activity truly represented Wda1 expression patterns. Wda1 was highly expressed in panicles at various developmental stages (Fig. 1K) but only very weakly in the roots and shoots of 7-d-old seedlings. Only low transcript levels were detected in the developing seeds and flag leaves. In developing spikelets, transcript was detected in all floral organs (Fig. 1K and 1L), but it was barely detectable in the wda1 anthers (Fig. 1L). LOC_Os02g40780, which is the most similar rice gene to Wda1, was also expressed throughout panicle development. However, its expression was much higher in the shoots and flag leaves. In mature spikelets, transcript levels were low in the anthers and palea/lemma and barely detectable in the ovaries and lodicules (Fig. 1L). These results indicate that Wda1 functions primarily in the panicles, especially in the reproductive organs, whereas LOC_Os02g40780 may play roles in both vegetative and reproductive organs.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0471100

Description

Sterol desaturase family protein

Version

NM_001071361.1 GI:115482465 GeneID:4348869

Length

5861 bp

Definition

Oryza sativa Japonica Group Os10g0471100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:17906207..17912067

Sequence Coding Region

17906494..17906655,17906746..17906922,17907019..17907117,17907202..17907402,17907731..17907838
,17907926..17908307,17908870..17909089,17910772..17911004,17911137..17911360
,17911825..17911884

Expression

GEO Profiles:Os10g0471100

Genome Context

<gbrowseImage1> name=NC_008403:17906207..17912067 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:17906207..17912067 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccacaaacccaggactcttcacggagtggccatggaagaagcttggcagcttcaagtacgtgttgctggcgccgtgggtagcgcacgggtggtatgaggtggcgaccaaggggtggcgggaggtggatctcgggtacatcgccatcctcccgtcgttgctgctgcggatgctgcacaaccaagcctggatcaccatctcccgcctccaaaacgcccgtggccgccgccagattgttcgccgcggcatcgagttcgaccaggttgaccgcgagaggaactgggacgaccagatcatcctgagcggtatcctactatacctcggcgcactgtacgtaccgggcgggcaacacttaccgctgtggaggacggatggcgcggggctgatcgccttgctgcatgcggggccagtggagttcctctactactggttccatcgtgcgttgcaccaccactttctctacacccactaccactcgcaccaccactcttcaatcgtcactgagcccatcacatccgtcatccatccgtttgctgagctcgttgcctacgaattgctcttctcgatcccactgatcgcctgtgccttgactggaactgcttccataattgcattcgagatgtatttgatttacattgatttcatgaacaacatggggcactgcaacttcgagttggtacccagctggctcttcacatggttccctcctctcaagtatctcatgtacacgccatcgtttcattctctgcaccacactcagtttcggacaaactactcccttttcatgccgttctacgattatatctacaacaccatggacaagtcatcagacactctgtatgagaactcactgaaaaacaatgaggaagaagaagcagtggatgtggttcaccttacacacctgaccaccctgcattccatctaccacatgaggcccggtttcgccgaatttgcgtccaggccctacgtttccaggtggtacatgaggatgatgtggcctctgtcatggctctccatggtgctgacatggacgtacggttcttcattcactgttgagaggaatgtcatgaagaagatcaggatgcagtcatgggccataccaagatacagtttccattatggattggattgggagaaggaagctatcaatgatcttatcgaaaaggcggtatgtgaagctgacaagaatggggctaaagttgtaagccttggactcctgaatcaggcacataccctgaataaaagtggagaacaatatctgctgaaatacccaaagttgggagcaagaattgtcgatggaaccagcttagctgctgcagtggttgtcaacagtatcccccaaggcacagaccaagtaattcttgcaggaaatgtttccaaggtggcgcgtgctgtagcgcaagcattatgcaagaaaaatatcaaagtcacgatgacaaacaagcaagattatcatttactcaagccagaaataccagaaactgtagctgacaatctttcgttttcgaaaacaggcaccgcaaaggtttggttaattggtgatggtctagattctgctgaacaattcagagcacagaaaggaactctgtttatcccatactcacaatttcctccaaagatggtacgcaaggacagctgcagctactcgacaactcctgcaatggctgtaccaaaaacgctgcagaatgtgcattcatgcgagaattggctgccaaggagggttatgagcgcatggcgaatcgcgggaattcttcatgcgttggagggatggaatgagcatgaatgtggtgacaaggtgcttgatatggacaaagtttggtctgctgcaattatgcatgggttctgcccagttgctcaaggttga</cdnaseq>

Protein Sequence

<aaseq>MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVD LGYIAILPSLLLRMLHNQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILS GILLYLGALYVPGGQHLPLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHS HHHSSIVTEPITSVIHPFAELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNN MGHCNFELVPSWLFTWFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKS SDTLYENSLKNNEEEEAVDVVHLTHLTTLHSIYHMRPGFAEFASRPYVSRWYMRMMWP LSWLSMVLTWTYGSSFTVERNVMKKIRMQSWAIPRYSFHYGLDWEKEAINDLIEKAVC EADKNGAKVVSLGLLNQAHTLNKSGEQYLLKYPKLGARIVDGTSLAAAVVVNSIPQGT DQVILAGNVSKVARAVAQALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSFSKTGTA KVWLIGDGLDSAEQFRAQKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQNVHS CENWLPRRVMSAWRIAGILHALEGWNEHECGDKVLDMDKVWSAAIMHGFCPVAQG</aaseq>

Gene Sequence

<dnaseqindica>5413..5574#5146..5322#4951..5049#4666..4866#4230..4337#3761..4142#2979..3198#1064..1296#708..931#184..243#atatgagactctgacacgtacgcacagctagatcgaagccctggtcgagtttataaattgagatatatccgtcctccattctcaggccagttcttgcaagactcttgccgtgttgagactgcagaaacgagagctagctagccagaggctgcaagaagattctgcacccatagatcgtctaccatggccacaaacccaggactcttcacggagtggccatggaagaagcttggcagcttcaaggtaatcaaaattaaccttccatcttcttctccttaattcagttacttcactgtcttctggcagctcgatcgagcaaataaacgcacagcttctagttccatccatggcagcactgcaccatgaccattatgttcttgtttgagttcgctagcttctgtttgatatcaaagcatacattgccgcatgtgcagctagcagtgcatgagattaattctcttgcatctgctgcagatcagtaatgcaggggcatgaactttcctgcagcacctctgtgcagcaaataaactgttaaagagtacatggttaaataagcttttgccacatcgtctttgattaggcaaaaacattcagtatacacaacttccgacctttacaaattacaacagtaacttcagctataaattatagcacatgtgagttaattcgatggatggattcatgcatgtatatgtgtgcatatgcagtacgtgttgctggcgccgtgggtagcgcacgggtggtatgaggtggcgaccaaggggtggcgggaggtggatctcgggtacatcgccatcctcccgtcgttgctgctgcggatgctgcacaaccaagcctggatcaccatctcccgcctccaaaacgcccgtggccgccgccagattgttcgccgcggcatcgagttcgaccaggttgaccgcgagaggaactggtatgccaaacaccataaaattacgtacaacccacgcggtgtgttcgtggcggctagcttcaccttcgagattaattaattcaacctcattatagttgatgtgttgttacgtgtatggtggtgtgcgtgcagggacgaccagatcatcctgagcggtatcctactatacctcggcgcactgtacgtaccgggcgggcaacacttaccgctgtggaggacggatggcgcggggctgatcgccttgctgcatgcggggccagtggagttcctctactactggttccatcgtgcgttgcaccaccactttctctacacccactaccactcgcaccaccactcttcaatcgtcactgagcccatcacatgtacgtaattaattgccactagagacggtttatcctcgaggctccaaacattacattctcttttaggcaataacctttgagcttctatattagtatcgaattgtgttgcgtcataaatatttttacaaaatttttattcatcatctaaagttatcaatgatcaaagttcaatcaatactaatagttacaagtaatttgaaatagaggaagtaagttgtactacctagttgtaccatcattgctccaaacaacctattacatgatattactttcgtcccaaacctctaaatgaatattaagattttggtaatacaaattcttaaaattttgagacagaaatattactagacctgtaaccttgggataaattaaaccacggtaatcttccaatagaacaaagtaaaaaacaagtcttttccataaggacacaaaacaggaggtgtacttcgtcagatgcaagtgtcgcgcgtgtccgttcctcaggaaacacagagtgttcctgtggccagtcgatcgctacttcaattccctcctccttcaatgcatgcctgaacaataattgtaggcctagagagtgtgtgagttaaggaatgcaaaggacacacgatatttcatggaccattgagatcgaagtaagccgaccgatcgatcgcgagctaaatttatgtagcccatcgaatccgttgctgaatgcctgaccaaacggagaagcaaacgtggtccatgaacaacgtatcagagacttttagacaagagagaaatcacattctaaggggttttttcccccttttttttgagtggaagagttttttttattgagaggtatcgagaagtactatatttttcgtgtaagctagccaaatatcagtgcgttgcaacttgcaacggattattaaaaatagcaaaattaagtccttgttaaattttttttaaaaaaaaatggttgaaacacaacttttcatcttaaagaaacaaacaaaaatgccatgcttagaaaattaaagagctaaagtatagtacagtatatatagtacaggcgactctcccaaaccttaataccatggcccatatatcagtgacccaggccctgggcaaactggtccacggcccagggcctgagatgaaaggcccgatgagaaatatgcatttttactaggaataagtctatttttcctcctttcaaccatgtaactttgtgttgggccaaaatttccatggggcggcctaggccttggcctatttctgggtccgccccttatcagtgattgtggtgatggcagattcactaccaccactactatcttttaatagtagtaaagattttggtgtcatcttgtaattttaagatgtacaagacggtaccataaattgactttaaagtgatttgaatggatgtgtaatgggagaaatcgcttttcaaatgtaaaataatgcactacttgtattagtactaaattttacattagagaacacgatatattcagtgattcttgataaccataaaatccctttaagattatggtgttttctttaagtactgttaaaaaaaaaccaatagtgtctactggttacactgcagaagaagagaaccctgcagactgcagtatttgtaattgagcaagcagatacatatacctaaatgcatatatgttcattacctacaattcctaacgttgttgcagccgtcatccatccgtttgctgagctcgttgcctacgaattgctcttctcgatcccactgatcgcctgtgccttgactggaactgcttccataattgcattcgagatgtatttgatttacattgatttcatgaacaacatggggcactgcaacttcgagttggtacccagctggctcttcacatggttccctcctctcaagtatctcatgtacacgccatcgtaagtacttcatcaggctcttaataatacttccttcttccttaaatgtttgacgccgttgacttttttaaacatgtttgaccgttcgtcttattcaaaaacttttgtgaaatgtgtaaaactatatgtatacataaaagtatatttaacaataaatcaaatgatagaaaaagaattaataattatttaaatttttgaataagacgaacggtcaaatatttttaaaaaagtcaatggcatcaaatattttgggatggagggagtatgtaaaagagtaactttacagtttttaagaaagcataggggaagtaccatattttatattggagaaattttacggttttcagtatttcttttaagataaaggaggctttattgatcttggatacaatatactctaaaaccactcctgatatctgcatagctaggatgcacatggtctatagttattgaaaaagccaaataaaagaagatgatgtgcatgtcactctgcaaaataaataacttgatcatacatgctgttttcactgttataataatctgaacttatgtgatatattaggtttcattctctgcaccacactcagtttcggacaaactactcccttttcatgccgttctacgattatatctacaacaccatggacaagtcatcagacactctgtatgagaactcactgaaaaacaatgaggaagaagaagcagtggatgtggttcaccttacacacctgaccaccctgcattccatctaccacatgaggcccggtttcgccgaatttgcgtccaggccctacgtttccaggtggtacatgaggatgatgtggcctctgtcatggctctccatggtgctgacatggacgtacggttcttcattcactgttgagaggaatgtcatgaagaagatcaggatgcagtcatgggccataccaagatacagtttccatgtaagagtaaccatgttcagtgcatgattcacagatggtgtgcatgataaattgataatcaggttagaaacattttgttttgtgcagtatggattggattgggagaaggaagctatcaatgatcttatcgaaaaggcggtatgtgaagctgacaagaatggggctaaagttgtaagccttggactcctgaatcaggtagctcatttcctaatgaattcagagcaagttgaaacattatcatccatacttcagaattcagatgttagctatatgtccacatgtactgccaaattttagtcaagataaaacagttagtgcttaataattgtttatcttcagggaaaaggtttagtcataaaggtaggaaaataaaaaaattaagtagcaaagagtccgttgacagtagtccaacagaactaataaattctgtacatttcatgagaatacaatatgtagaaattagggaagtatgtactcatgcatggttgaactggtaattgacatacaatatcttcaatataaggcacataccctgaataaaagtggagaacaatatctgctgaaatacccaaagttgggagcaagaattgtcgatggaaccagcttagctgctgcagtggttgtcaacagtatcccccaaggcacagaccaagtaattcttgcaggaaatgtttccaaggtggcgcgtgctgtagcgcaagcattatgcaagaaaaatatcaaagtaattaatccactactcacctctgatttattttatagcatgcaaaaggataccatgttgtaacaaaccactattcttgtacaggtcacgatgacaaacaagcaagattatcatttactcaagccagaaataccagaaactgtagctgacaatctttcgttttcgaaaacaggcaccgcaaaggtaagaatagatttcctcatttttcctacattctctggacaaatgaatagaatgtataagagaaatatcattgcctaataaaccaaaaattttcaggtttggttaattggtgatggtctagattctgctgaacaattcagagcacagaaaggaactctgtttatcccatactcacaatttcctccaaagatggtacgcaaggacagctgcagctactcgacaactcctgcaatggctgtaccaaaaacgctgcagaatgtgcattcatgcgaggtagtagtaataacctgttgaaataatccagagattcagacgaacttcacatgatctaatcacaaaatttttgaactttttttttgacagaattggctgccaaggagggttatgagcgcatggcgaatcgcgggaattcttcatgcgttggagggatggaatgagcatgaatgtggtgacaaggtgcttgatatggacaaagtttggtctgctgcaattatgcatgggttctgcccagttgctcaaggttgatgattcagttgcaaagtatcagaataagttttagctggattatgctatgtggtcaccgtatcagaaagagagatgttctgttggcaagaagagatatagtatctgagtaatttcatctgccatggtttttaaaacattgttcatcatctcctttgatcaaagactggccatggctactttctgtataagtatctgtcctttttagtccatagtgtaattcagcaacaaaacactcttggcattgttatgcagtctcatgaatgtttttccagcatacggaattacgg</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0471100, RefSeq:Os10g0471100