Difference between revisions of "Os06g0701300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
''OsABC1-8''is located in chromosome 6 with 18 extrons. This gene encodes a protein with 695 amino acids.
 
===Function===
 
===Function===
Please input function information here.
+
Members of the activity of bc1 complex (ABC1) family are widely existed in prokaryotes and eukaryotes as protein kinases. These protein kinase members were initially isolated from Saccharomyces cerevisiae and were responsible to suppress a defect in mRNA translation of cytochrome b and maintain the activity of the bc1 complex in the mitochondrial respiratory chain <ref name="ref1" />. Mitochondrial and chloroplast ABC1 proteins is associated in respiratory electron transport system and as a lipid-soluble antioxidant in ''yeast'', ''Escherichia col'', and human <ref name="ref2" /><ref name="ref3" />.
 +
There are 15 non-redundant ABC1genes distributed on all rice chromosomes randomly except chromosomes 3, 8, 10, and 12 in rice, and were named from OsABC1-1 to OsABC1-15 according to their chromosomal location (table 1). However, there are 17 members of ABC1 family in ''Arabidopsis''. All of these genes contain introns and the number of intron varies greatly, and intron gain was an important event accompanying the recent evolution of the rice ABC1 family <ref name="ref4" />.
 +
[[File:abc1-table.jpg|middle|thumb|530px|'''Table.1'' Basic information of the rice ABC1 genes.(from reference) <ref name="ref4" />.]]
 +
ABC1 domain is an important part of the ABC1 proteins, and aligned results show that the domains of all proteins were from 102–126 amino acids, except the OsABC1-14 and OsABC1-15 proteins. The length of the domain in OsABC1-14 and OsABC1-15 is 92 amino acids and 184 amino acids, respectively <ref name="ref4" />. The XaXasX2QV segment that functions as a nucleotide-binding motif for protein kinases is highly conserved in ABC1 domain as well as lysine residue in N-terminal that as a binding site for chemical groups. In addition, other conserved amino acid valine and aspartate acid in the middle of the domain and glutamate acid in the C-terminal. It is also suggested that there are 10 putative motifs in rice ABC1 proteins (Fig1).
 +
[[File:motif10.jpg|middle|thumb|430px|'''Fig.1'' Motif composition of rice ABC1 proteins.(from reference) <ref name="ref4" />.]]
 +
The real-time PCR results show that 14 genes express mainly in leaves. The subcellular localization is predicted that OsABC1-1 and OsABC1-8 were localized in the cytoplasm, OsABC1-3 and OsABC1-6 in the plasma membrane, OsABC1-10 in mitochondria, OsABC1-14 in vacuoles and the others in chloroplasts <ref name="ref4" />.
 +
Members of this family participate in the extensive abiotic stress response and may play roles in the tolerance of plants to adverse environments. Furthermore, some of the rice ABC1 genes may be involved in the oxidative stress response and ABA signaling<ref name="ref4" />.
  
 
===Expression===
 
===Expression===

Revision as of 09:17, 26 June 2014

Please input one-sentence summary here.

Annotated Information

OsABC1-8is located in chromosome 6 with 18 extrons. This gene encodes a protein with 695 amino acids.

Function

Members of the activity of bc1 complex (ABC1) family are widely existed in prokaryotes and eukaryotes as protein kinases. These protein kinase members were initially isolated from Saccharomyces cerevisiae and were responsible to suppress a defect in mRNA translation of cytochrome b and maintain the activity of the bc1 complex in the mitochondrial respiratory chain [1]. Mitochondrial and chloroplast ABC1 proteins is associated in respiratory electron transport system and as a lipid-soluble antioxidant in yeast, Escherichia col, and human [2][3]. There are 15 non-redundant ABC1genes distributed on all rice chromosomes randomly except chromosomes 3, 8, 10, and 12 in rice, and were named from OsABC1-1 to OsABC1-15 according to their chromosomal location (table 1). However, there are 17 members of ABC1 family in Arabidopsis. All of these genes contain introns and the number of intron varies greatly, and intron gain was an important event accompanying the recent evolution of the rice ABC1 family [4].

'Table.1 Basic information of the rice ABC1 genes.(from reference) [4].

ABC1 domain is an important part of the ABC1 proteins, and aligned results show that the domains of all proteins were from 102–126 amino acids, except the OsABC1-14 and OsABC1-15 proteins. The length of the domain in OsABC1-14 and OsABC1-15 is 92 amino acids and 184 amino acids, respectively [4]. The XaXasX2QV segment that functions as a nucleotide-binding motif for protein kinases is highly conserved in ABC1 domain as well as lysine residue in N-terminal that as a binding site for chemical groups. In addition, other conserved amino acid valine and aspartate acid in the middle of the domain and glutamate acid in the C-terminal. It is also suggested that there are 10 putative motifs in rice ABC1 proteins (Fig1).

'Fig.1 Motif composition of rice ABC1 proteins.(from reference) [4].

The real-time PCR results show that 14 genes express mainly in leaves. The subcellular localization is predicted that OsABC1-1 and OsABC1-8 were localized in the cytoplasm, OsABC1-3 and OsABC1-6 in the plasma membrane, OsABC1-10 in mitochondria, OsABC1-14 in vacuoles and the others in chloroplasts [4]. Members of this family participate in the extensive abiotic stress response and may play roles in the tolerance of plants to adverse environments. Furthermore, some of the rice ABC1 genes may be involved in the oxidative stress response and ABA signaling[4].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0701300

Description

Beta-lactamase family protein

Version

NM_001065018.1 GI:115469767 GeneID:4341968

Length

7696 bp

Definition

Oryza sativa Japonica Group Os06g0701300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:30393289..30400984

Sequence Coding Region

30394072..30394222,30395429..30395457,30395541..30395613,30396650..30396807,30396888..30397014
,30397101..30397176,30397251..30397308,30397393..30397491,30397582..30397710
,30398236..30398357,30398470..30398638,30398732..30398832,30398985..30399111
,30399187..30399276,30399419..30399505,30399606..30399833,30399932..30400006

Expression

GEO Profiles:Os06g0701300

Genome Context

<gbrowseImage1> name=NC_008399:30393289..30400984 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:30393289..30400984 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggatggggaaacaccttaaccaggcgcctcaaagtcttttccatggccttgtttatatacttcgactataaggcagttcagaagagagttaaatgggttggcgctggtaaaaaggatgctatatggacaaaaacacacgagcgaaatgctcgtcgtgttctcaacctgatgatagagttagaaggtttatgggtgaaaatgggacaatatttatccacaagagcagatgtgcttcctgaaccctacataaatgtcctcaagcagttgcaggactcgcttcctcctcgccctcttgaagaggttcgtggaaccatagagaaagaacttgggaaacccatgaatgatctgtttgctaattttgtgctggatcctctagcaactgcatcaatagcacaggttcatcgtgcaactcttgtagatggcagagaagtagttgtgaaaatccaacatgatggtatcaaagatatcatattagaggatttgaagaatgcaaaatcattagttgaatggattgcatgggcagagcctcaatataattttaacccgatgatagatgaatggtgcaaggaggcaccaaaggaacttgatttcaaccatgaggcagagaacacaaaggctgtctccagtaatcttagtcgaaaaaccaattgcgagagtggtgctgtctctagtgctgttgacgtactgattccagaagttattcagtcaactgataaggttctaattttgcaatatatggatggaattcgtttgaatgacaatgattcgttagaagcatatggtgttgataagcaaagacttgtggaggagataacccgtgcatatgctcatcaaatatacgttgatggcttctttaacggcgatcctcaccctggcaattttcttgttagcaaggaacctccacacaagccgattctccttgattttgggcttactaaacgcatatctcaatcaatgaggcaggcactagcaaagatgtttttgtcatgcgctgagggagaccatgtggcactgctgtcagcctttgcggagatggggcttaagctgcgggttgacatgcctgagcaggctatggagatcgctacagtattttttcggcagtccactacagcaaatgaagcaaaggagaacataaagacattgaatgaccaaagagaacgaaatgtcaaggcacttcaagaaaagatgaaaatgaataaaaaggaggttcaacgtttcaatccagttgatgctttccctggtgatgcaattatattcatgagggttttgaatcttcttagagggctatcagcatcactaaatgttaggatagtttatctagacatcatgaggccatttgctgaatcaactttgctagggagtatgacacgtgggcccacagctaacagtcagtggatttatgactcacctgttaactcagaggtggagtctaaactgcggaaccttctgcttgagttgggaagcaacaaaattttaggaatacaagtttgtgcttataaagatggaaaggtcataatagataccgctgctggtacgttagggaagtatgatccacgtcctgttcaacctgattctctctttccagttttttcagtgacaaagggtatcactgctggcatggtgcattggcttgttgacaaagggaagttgaagtatgaggagactgttgccaatatatggccaaaattcggaactaacaaaaaagagctaataaaggttcatcatcttctgaatcatacatctggctcgatactacgccgcgctgggggcaggcggcgccattcctccgccgcactccggtggtggctccaagccgccactcggcagccatgtccacacccccaagttccccaccatgccgtccaagaagaagaagaagggaggttcgaagaatga</cdnaseq>

Protein Sequence

<aaseq>MGWGNTLTRRLKVFSMALFIYFDYKAVQKRVKWVGAGKKDAIWT KTHERNARRVLNLMIELEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEV RGTIEKELGKPMNDLFANFVLDPLATASIAQVHRATLVDGREVVVKIQHDGIKDIILE DLKNAKSLVEWIAWAEPQYNFNPMIDEWCKEAPKELDFNHEAENTKAVSSNLSRKTNC ESGAVSSAVDVLIPEVIQSTDKVLILQYMDGIRLNDNDSLEAYGVDKQRLVEEITRAY AHQIYVDGFFNGDPHPGNFLVSKEPPHKPILLDFGLTKRISQSMRQALAKMFLSCAEG DHVALLSAFAEMGLKLRVDMPEQAMEIATVFFRQSTTANEAKENIKTLNDQRERNVKA LQEKMKMNKKEVQRFNPVDAFPGDAIIFMRVLNLLRGLSASLNVRIVYLDIMRPFAES TLLGSMTRGPTANSQWIYDSPVNSEVESKLRNLLLELGSNKILGIQVCAYKDGKVIID TAAGTLGKYDPRPVQPDSLFPVFSVTKGITAGMVHWLVDKGKLKYEETVANIWPKFGT NKKELIKVHHLLNHTSGSILRRAGGRRRHSSAALRWWLQAATRQPCPHPQVPHHAVQE EEEGRFEE</aaseq>

Gene Sequence

<dnaseqindica>6763..6913#5528..5556#5372..5444#4178..4335#3971..4097#3809..3884#3677..3734#3494..3592#3275..3403#2628..2749#2347..2515#2153..2253#1874..2000#1709..1798#1480..1566#1152..1379#979..1053#tgtctgaactctgaactctctctctctctctctctcctcctcttcccggcggagtcccccacctcgcctcccctccctgcgcgcggcaccaccggcgggaaggtctccggagtgcgcggcggtgtggacgtcttcctaccctccccgtcccaaccccgcggccgcttcgttcttggtcgtcctcggtgtgttcttgttgttgttgttgttgttcggatcgagttgatttcgtgcccctcccattatggaatcaggtttcttcagggtttctctgatgtagggtagaagattgtttggagaggccaagaaaaaaaaagttcttttggagttcagctgaactcgttgttaggtcgtttgcccctgatttagattcgattctgaggtaataaagttgcggaattgtggatgtccggaggatatccgagggttttatccgctcaatttgatgtgatcaagcaaaaaattcgtttctttttatgtttaaaggccttaatactacacaagctagtagtagtttgttttcttctgctctactgcaaaagtaagtactccttgtttgcatcccttggtggctttccagtacctaccatctgatgttgtagctccttggaaactgcttgcttatccctttgtcatgataagaatgtggtgtgaggaagaaacctgtattctttgtagttatacgctttatttgctttccttaaactctgtctttgtctgatttaatgtaaatacaagctgtcgcgcgaattcgttatcttgtcatgacttgtcaagaacagaagaacagtcctttctatgaagaagttttgagcctattgtatgtgatcggtagtgactaaggaatgctgatttggatttaccttcttgtacttgtgacattgcagaagatcaaccgtctggccgggagcctagagttgttaactacggtgtttcagagtttttttgttatctcttctgctgttgtgctgacttctaatgggatggggaaacaccttaaccaggcgcctcaaagtcttttccatggccttgtttatatacttcgactataaggtgtggttgtatcacttcttcatgctgttctttcaataaaaagtctcaatccattctactagtagaagcagattaacatcttcttgaggtacaagcaggcagttcagaagagagttaaatgggttggcgctggtaaaaaggatgctatatggacaaaaacacacgagcgaaatgctcgtcgtgttctcaacctgatgatagagttagaaggtttatgggtgaaaatgggacaatatttatccacaagagcagatgtgcttcctgaaccctacataaatgtcctcaagcagttgcaggactcgcttcctcctcgccctcttgaagaggttcatcctcataactaattttgcttcatctgtagtcaatccaaatattaacatgtagctaatcgtagtcgttaactcaattcttgtctctcatgttcaggttcgtggaaccatagagaaagaacttgggaaacccatgaatgatctgtttgctaattttgtgctggatcctctagcaactgcatcagtaagttctgttatattggaatgaacttctttcatctgatggaaattcatagtatgttttttttgacgaaatcctcgagcaacttgctaattttttttgtcatggtagtatgttcatacgagtcttcatgtacttttgtcagatagcacaggttcatcgtgcaactcttgtagatggcagagaagtagttgtgaaaatccaacatgatggtatcaaagatatcatattagaggtttgcctctattctgaaaaaacggacttatgtaaaatgtgcaggattgctatatcattttcttaatgttgtcaggatttgaagaatgcaaaatcattagttgaatggattgcatgggcagagcctcaatataattttaacccgatgatagatgaatggtgcaaggaggcaccaaaggaacttgatttcaaccatgaggcaggtaattacccctttcagttctcatactcctctctccatataaaagaacatgcatgctcttgtgactcatccatattttttttaaaagtaaaggtctagtcactaatgaacatatcatcctgataatgtatgctataaaatccttaattttagagaacacaaaggctgtctccagtaatcttagtcgaaaaaccaattgcgagagtggtgctgtctctagtgctgttgacgtactgattccagaagttattcaggtctgagttcttttacttcatcctgtttgtcatcgtgtcagtttttccggttcagttgacagatcatctaatccattcttctttgtgtaccagtcaactgataaggttctaattttgcaatatatggatggaattcgtttgaatgacaatgattcgttagaagcatatggtgttgataagcaaagacttgtggaggagataacccgtgcatatgctcatcaaatatacgttgatggcttctttaacggcgatcctcaccctggtatttcaattttatgtgccttgaagagatcttctgtcacctcaatttttttattctccatctgtaattcttgcaaattcatttgtgctgacaatgcattatttttctgtaggcaattttcttgttagcaaggaacctccacacaagccgattctccttgattttgggcttactaaacgcatatctcaatcaatgaggcaggcactagcaaagatgtttttgtcatgcgctgaggtttgacactttgatcttctaaataatacatacacaaggaaacaaataatggagttaatcaaacatggttgtcttgttggcatctacaagctgcagccatttccattggagtagatgcgatcttttattataacaagaatggatttttgtttactttccgatctttttgtatcctagtttagtcctatctttcagtctttactcataagtggtattgcaaagtggcagatgaatatcacatttaacaagctataagaaaacaaagacagaatctggaactaatctttattttcttctctactatgctttggtgttccttgaatcaactttgagacttagaaagtgcactggaacgttaagtgaccacatgcactagtattttgacgtgtcaaaatttgataattaaaattttgtgagatagggttcttcggtttattctaccttttgctgtttgtgaaccagttgctcatgctatgattaaatttcttaaactacatttctgatatttaacatgtcaatgggtagggagaccatgtggcactgctgtcagcctttgcggagatggggcttaagctgcgggttgacatgcctgagcaggctatggagatcgctacagtattttttcggcagtccactacagcaaatgaagcaaaggtaggaggctaccactactgtaatctgtatccctcctcttgtattaatttggaagtttggattaactgtttggttatgacttttctttaggagaacataaagacattgaatgaccaaagagaacgaaatgtcaaggcacttcaagaaaagatgaaaatgaataaaaaggaggttcaacgtttcaatccagtgagtaggcatgccttttacttcatatgtgtttagtttgtcaaccaagaaataggtgttacatgaacattttctcgcctttaggttgatgctttccctggtgatgcaattatattcatgagggttttgaatcttcttagaggtatgtttttcattctttcctttgaaatatccagtatcatggtaacatgctctctattatctgcacttatgcagggctatcagcatcactaaatgttaggatagtttatctagacatcatgaggccatttgctgaatcaactttgctagggtgagatgcctgtttatctactgtttgcaggagccttagagtaaagcatcttttttattgcttatttatgccttcgttgatggtaggagtatgacacgtgggcccacagctaacagtcagtggatttatgactcacctgttaactcagaggtggagtctaaactgcggaaccttctgcttgagttgggaagcaacaaaattttaggaatacaagtaggttgataatctcatgcgattcatttacatgctatgactttgcttcattggtgccttacaaatcttccttttaccaggtttgtgcttataaagatggaaaggtcataatagataccgctgctggtacgttagggaagtatgatccacgtcctgttcaacctgattctctctttccagttttttcagtgacaaagggtatcactgctggcatggtgcattggcttgttgacaaagggtgagtgcttaatcacaatgccaagttttttttttcttaacatgctagtgtaaatatgtttgcaggccgtcgtattacagtacattatactacctcagattccaaataagtcgtttagacttatgcacaagaattaagaaaacaacagaactgactattttaccctacacttatactacatgaaagatatgaatcatttatttgttgagagagctagcatttatttgccaaggtcaagcatggaagagaagatgaagaagtggctagaagttccaaaacgacttatatttagaatacctcatcttagtagcttactagtgtatcaaaaataatatttggcctaacagtaacgagcatggtagtatgccaccctgtttaagtaggcctcctcttgatctactaacattctaacaaaataaagatattccatctttatatacatggcaaagtcactcacatgcgcaaacaacttttattctgaagcatcaaattgttgtaccgtatttctgtgagtctatgttgaacaataaaaatggacatggagaatgggtgccagtgttcccatgattaggctgaaccatgttagtgcaggtggcaatccttcacaattatgacatgtgagtcactgttgaaacataaaatttagattggtgcagtgtagtttcctgcagttgcatccacgttatccaggtcacaatatttcttgatattatctacattctagtgcttaaaaagtataaagcatcagattcttgtataaagcaagcaactcctctaaatctctaacagtgatggtactacagagaacattgagcatcttttccctgctaccttaggcttttatgtgcattgcaatccattagtgacaggctgagaaaggcctggggtcttctggctagcaccacaagatgtgggctagccgacccaggttcaagcctcacccctcttgataaattttgatatgagaatctttcctctcatatccagtgtttttttattattagtgacaggctgacagcatactgttatctttcaggaagttgaagtatgaggagactgttgccaatatatggccaaaattcggaactaacaaaaaagagctaataaaggtactagaacttctttttttgttgtttgttgaaacactgtttcttgggattaacagactctgatttgcaattttctactaaaggttcatcatcttctgaatcatacatctggtttacataatgcattgggagatgtgatgaagagtgatccgttgttggtatgtgactgggaagagatgctgcaccagattaccaagtgtacgccggaaacagaaccgggttctgaacaaatgtatcactacttatcctttggttggctgtgtggtggaatcatagaggtatgtctctcccgagcatcacatacaccgagttcatttattttcaatgggagtactgaacctttttaactggatcagtggatctttatggcttcacatagttatactaatttttaatctggttatgggcttaattaaatgcacagcccaccaagttatatttttttggttatgggctattggcaaagtagaggtaaataactgaaaacaacacgtgtttgtatgtcactgttctgtgtgaacttaatttcatgaatcctaacgctgatatttggtgataatagcatgcgtccggaaagaagcttcaagaggtcctagaagaggccattgttcatcctcttcacattaacggggagctatatattggcattcctccaggtataactaacaaaacttcccagtttagctttcaacaaaataggtgtacgcattgatataatgatggatattttttttttctacaaatccataaacatattaaccttttcgagacgtgttcatgtcatataagtttgatgagtgaaaaaattgcgctagatacttaccttttttttgcggggtgctatattcttgctattattactgttccaaagattatttgaaaagagactacaatgcatatgtgaagtacagtcatgagttcgatgcttgtccaaagaacgcattttctctgtctctggcttgttttgacatgttccataaacatactcacccacgcttttggagatgtgttccataggtttgatgagtgaaattgctgctatattcttaccgttgtagataatatcctacatgtgaatatgtgatgttcatcgattttccgcccttgtcaggtgtcgaatctcgccttgcggcactgacagtcgacatggaggagctcgagaagctgtcaggattcagagcaggaccagacgtcccacaggagctgctcagcaatgtcgcccagatggccaccggcctacctgtcctcttcaacacgctcaacatccgccgcgccatcctccccgctgccaatggccactgctcggcgcgcgctctggctcgatactacgccgcgctgggggcaggcggcgccattcctccgccgcactccggtggtggctccaagccgccactcggcagccatgtccacacccccaagttccccaccatgccgtccaagaagaagaagaagggaggttcgaagaatgatgtcggcgtcgctgacaaggacgggtacacccagctccgcaccagcgacggcagcgacgaggggtcgacggtgtcagcggtggtggccgggaacggcagtggcagcggcagcagcatgttcgtcgacggcggcaccaagatgctcgacgcgttcatgggcgtcggcgacttctccggcatgatccacccgaacggcaagttcgggctcgggttcaggaggtacggctatggcgccggcgctggcgagaaggtggcgacgacgacgttcgggcactccgggatgggcgggtcgacggggttctgcgacgtggagcacgggctggccatggccgtgacggtgaacaagatgtcgctgggcggcgtgacgcggcgcgtggtccggctggtgtgcgaggagctgggcgtgccggtgcccgacgagttctccgtcgccggcgacaagggccccgacatggtgctcaacctcgcgccgccggagtagcaccaacctgccaggccactactactgacatttcatcatacactttgatacatatacacatgtagctaggtaagagtaaactcatgatgatataacaaaatgaggggaaaaattaatgttctttccgggtatacgtattagtacaatatagtagtacaaatttatgccatttggatgtggcttcgtcatatatactccaaattatacatgtatacaagatttttgtttcatttttcctgtttacatttgcaactgtgaggtgccaagtgatgccatgttggaaaattcgaatatgctgttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0701300, RefSeq:Os06g0701300

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 4.2 4.3 4.4 4.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref4