Difference between revisions of "Os03g0327800"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 +
*Os03g0327800 encoding a Oryza sativa NAC-like, activated by apetala3/pistillata (OsNAP). Overexpression of OsNAP significantly promoted senescence, whereas knockdown of OsNAP produced a marked delay of senescence, confirming the role of this gene in the development of rice senescence.
 +
 
 +
*ABA Participates in Leaf Senescence and the expression of OsNAP can be induced by ABA. ABA-mediated leaf senescence might be dependent on the modulation of OsNAP expression, which, in turn, either directly or indirectly regulates the expression of senescence-associated genes (SAGs). Also, this is a feedback mechanism between ABA and OsNAP, OsNAP can inhibit the expression of key ABA biosynthesis genes.
 +
 
 +
 
 +
[[File:nap1.jpg]]
  
 
===Expression===
 
===Expression===

Revision as of 11:59, 1 July 2014

Please input one-sentence summary here.

Annotated Information

Function

  • Os03g0327800 encoding a Oryza sativa NAC-like, activated by apetala3/pistillata (OsNAP). Overexpression of OsNAP significantly promoted senescence, whereas knockdown of OsNAP produced a marked delay of senescence, confirming the role of this gene in the development of rice senescence.
  • ABA Participates in Leaf Senescence and the expression of OsNAP can be induced by ABA. ABA-mediated leaf senescence might be dependent on the modulation of OsNAP expression, which, in turn, either directly or indirectly regulates the expression of senescence-associated genes (SAGs). Also, this is a feedback mechanism between ABA and OsNAP, OsNAP can inhibit the expression of key ABA biosynthesis genes.


Nap1.jpg

Expression

Please input expression information here.

Mutation and Phenotype

Please input evolution information here.


other information

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0327800

Description

No apical meristem (NAM) protein domain containing protein

Version

NM_001056532.2 GI:297600855 GeneID:4332717

Length

2417 bp

Definition

Oryza sativa Japonica Group Os03g0327800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:12024636..12027052

Sequence Coding Region

12026216..12026613,12026708..12026873

Expression

GEO Profiles:Os03g0327800

Genome Context

<gbrowseImage1> name=NC_008396:12024636..12027052 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:12024636..12027052 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggttctgtcgaacccggcgatgctgccgccggggttccggttccacccgacggacgaggagctgatcgtgcactacctccgcaaccgggccgcctcctcgccgtgccccgtctccatcatcgccgacgtcgacatctacaagttcgatccgtgggacctcccatccaaggagaattacggggacagggagtggtacttcttcagcccgagggaccgcaagtacccgaacgggatccggccgaaccgcgccgcgggctccggctactggaaggccaccggcaccgacaagcccatccacagcagcggcggcgcggcgaccaacgagagcgtcggcgtcaagaaggcgctcgtcttctacaagggccgcccgcccaagggcaccaagaccaactggatcatgcacgagtaccgcctcgccgccgcagacgcccacgccgccaacacctaccgccccatgaagttccgcaacacctccatgagggtaagcaagctccatctacgttacctagcagccagattcaaattatctaaaccaaacaacttaattatgaacaaaccctag</cdnaseq>

Protein Sequence

<aaseq>MVLSNPAMLPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADV DIYKFDPWDLPSKENYGDREWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSS GGAATNESVGVKKALVFYKGRPPKGTKTNWIMHEYRLAAADAHAANTYRPMKFRNTSM RVSKLHLRYLAARFKLSKPNNLIMNKP</aaseq>

Gene Sequence

<dnaseqindica>440..837#180..345#aaattcgagccctcctccatctctcgcctcctcttgatacaagctcgaccctgatagatctcatagatcatagctgagaggggatcgagtggcttgatcttggaagtgagcagctatagctagataggttttgcttgtgcagggaggtgtgtgttgtgtgtgggtgactgccggagacgatggttctgtcgaacccggcgatgctgccgccggggttccggttccacccgacggacgaggagctgatcgtgcactacctccgcaaccgggccgcctcctcgccgtgccccgtctccatcatcgccgacgtcgacatctacaagttcgatccgtgggacctcccatgttagtacccaccctcacagctcgccgcgatcgatcgatcactgatttgcaattaatttcgttggtgatcgacttgtgttttgatttgcatcagccaaggagaattacggggacagggagtggtacttcttcagcccgagggaccgcaagtacccgaacgggatccggccgaaccgcgccgcgggctccggctactggaaggccaccggcaccgacaagcccatccacagcagcggcggcgcggcgaccaacgagagcgtcggcgtcaagaaggcgctcgtcttctacaagggccgcccgcccaagggcaccaagaccaactggatcatgcacgagtaccgcctcgccgccgcagacgcccacgccgccaacacctaccgccccatgaagttccgcaacacctccatgagggtaagcaagctccatctacgttacctagcagccagattcaaattatctaaaccaaacaacttaattatgaacaaaccctagcagctggatcttgctatcgatggagtagagagtagatcgtctattattcatctctgtctgatgtgctagtgcacttgcacagttgcacaccgtggtttttttgggtggttgtttctgatgatcgatacgtgttcgtcggcacgtcagtattatcgcatcggtttgtgccttgccaatggacgcaactcgctgcttttagtgtgtctgttttaaagagggtgttctttaggcaatacttggcatggttgcgcaagtcaatagatccgacaatgatagccacgatgcgtacgtgttgatgactggttcatctctgcatatgcgcgcatgcataccccctgaaattaatcccttctatttttgatactcttaatttcttaatcatatagtatatgcatccgtgtgattgatcgatcgatgtgcgtggatttttgtgcagctggatgactgggtgctgtgccggatctacaagaagagcagccacgcgtcgccgctggccgtgccgccgctctccgaccacgagcaggacgagccgtgcgccctggaggagaacgcgccgctgtacgcgccgtcgtcgtcgagcgccgcatccatgatcttgcagggcgctgccgccggcgccttcccgtcgctgcacgccgccgccgccgctacgcagaggacggcgatgcagaagatcccttccatttccgacctgctcaacgagtactcgctgtcgcagctcttcgacgacggcggcgccgccgccgccgcccccctgcaggagatggcgaggcagcccgaccaccaccaccaccaacaacaacaacacgccctctttggccaccccgtcatgaaccatttcatcgcgaacaacagcatggttcagctcgcgcacctggacccgtcctcctctgcggccgcctcgacgtcggcaggcgccgtcgtcgagccgccggccgtcaccgggaagcgcaagagatcatcggacggaggcgagccgacgatccaggcgctgcctcctgctgccgcggcggccaagaagccgaacggttcatgcgttggtgcaactttccaaataggcagcgccttgcagggatcgtcactgggactgagccaccagatgctgctccactctaacatggggatgaactgatagctcgttcttcgtacataataccacagcctgattaaacactgaacataattgcacatggcgaattgatgatttgaacagtgaggtctatttcgaaagcaaataggtccaaaacgatagatttaaatagtaaatatattgggaaagaaattgtacttaatttgtacttgtgtggactagctaggtcgtccgatcatgcatagctatatagtttgtggtgtgtatacattttttctcatggtactatactactgtgtactcaagctagctcagtactaaagattaattaagctagataggggttgataagactttgagatagacccactagaagtctggaacatgagatcaaggagaatgatgtcaagatcataaagccggatttatagctcatattcatgtaaatcaatcaataagtgattctttaatggcagccactcattttttt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0327800, RefSeq:Os03g0327800