Difference between revisions of "Os03g0267200"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
'''''sHSP17.7''''' is a '''small heat-shock protein gene''' in rice<ref name="ref1"/><ref name="ref2"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
The '''molecular chaperone activity''' of ''sHSP17.7'' was investigated using catalase as a '''substrate'''. Recombinant ''sHSP17.7'' had '''heat-stable chaperone''' properties that were capable of '''protecting stressed catalase''' from '''precipitation'''<ref name="ref2"/>.
 +
 
 +
===Mutation===
 +
*Drought tolerance was assessed in the transgenic lines and wild-type plants by withholding water for 6 days for evaluation of the ability of plants to continue growth after water-stress treatments. Although no significant difference was found in water potential of seedlings between transgenic lines and wildtype plants at the end of '''drought treatments''', '''only''' transgenic seedlings with '''higher expression levels''' of ''sHSP17.7'' protein could regrow after rewatering. Similar results were observed in '''survival rates''' after treatments with '''30% polyethylene glycol''' (PEG) 3640 for 3 days<ref name="ref1"/>.
 +
 
 +
*After '''heating''', the '''survival rate''' of ''sHSP17.7'' cells was 2-fold '''higher''' than that of the control cells<ref name="ref2"/>.
 +
 
 +
*Transgenic rice plants with '''increased levels''' of ''sHSP17.7'' protein exhibited significantly '''increased thermotolerance''' compared to untransformed control plants. The level of increased thermotolerance was correlated with the level of increased ''sHSP17.7'' protein in the transgenic plants<ref name="ref2"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*Western and Northern blot analyses showed '''higher expression levels''' of ''sHSP17.7'' protein in three transgenic lines than in one transgenic line. Overproduction of ''sHSP17.7'' could '''increase drought tolerance''' in transgenic rice seedlings. <ref name="ref1"/>. Overexpression of ''sHSP17.7'' in rice confers '''higher thermotolerance''' and '''UV-B resistance'''<ref name="ref2"/>.
 +
 
 +
*''sHSP17.7'' was overexpressed in the rice cultivar ‘Hoshinoyume’, by ''Agrobacterium''-mediated transformation, under the control of a CaMV 35S promoter<ref name="ref2"/>.
 +
 
 +
*The transgenic rice plant with the highest constitutive expression of ''sHSP17.7'' had significantly '''greater resistance to UV-B stress''' than untransformed control plants. Increase in the degree of resistance of transgenic plants to UV-B was accompanied by an increase in production of ''sHSP17.7'' protein<ref name="ref2"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: nine OsHSP genes.jpg|right|thumb|300px|'''Figure 1.'''''Gene tree of the nine rice HSPs(from reference <ref name="ref3"/>).'']]
 +
*Gene tree were conducted using the software Molecular Evolutionary Genetics Analysis (MEGA) Version 4.0 by the neighbor-joining method with pairwise deletion and the Poisson correction model<ref name="ref3"/>.
 +
*As shown in Figure 1, based on amino acids sequence homology, nine OsHSP genes were divided into three classes, among them ''OsHSP80.2'', ''OsHSP74.8'' and ''OsHSP50.2'' belong to ''HSP90'' family; ''OsHSP71.1'', ''OsHSP58.7'' and ''OsHSP23.7'' belong to ''HSP70'' family; ''OsHSP26.7'', ''OsHSP17.0'', ''OsHSP24.1'' and ''OsHSP17.0'' belong to '''sHSP family'''<ref name="ref3"/>.
 +
 
 +
===Knowledge Extension===
  
You can also add sub-section(s) at will.
+
*Heat shock proteins (Hsps) belong to a class of proteins that are conserved in prokaryotes and eukaryotes and are especially abundant in plants. Hsps are highly expressed in plants and other organisms after being stimulated by high temperature and other stresses. The sHsps are much more abundant in higher plants than in other organisms<ref name="ref4"/>.
 +
*Expression of nine ''OsHSP'' genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of ''OsHSP80.2'', ''OsHSP71.1'' and ''OsHSP23.7'' were increased during salt tress treatment. Expression of ''OsHSP80.2'' and ''OsHSP24.1'' genes were enhanced while treated with 10% PEG. Only ''OsHSP71.1'' was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine ''OsHSP'' genes may play different roles in plant development and abiotic stress responses<ref name="ref3"/>.
 +
*According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs<ref name="ref5"/>. Most HSPs function as molecular chaperones in maintaining homeostasis of protein folding and are thought to be responsible for the acquisition of thermo tolerance<ref name="ref4"/>. It is believed that the accumulations of HSPs play a pivotal role in abiotic stress.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Agricultural Research Center for Hokkaido Region, Hitsujigaoka 1, Toyohira-ku, Sapporo 062-8555, Japan
 +
*Hokkaido Green-Bio Institute, Naganuma, Hokkaido 069-1301, Japan;
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Sato Y, Yokoya S. Enhanced tolerance to drought stress in transgenic rice plants overexpressing a small heat-shock protein, sHSP17. 7[J]. Plant cell reports, 2008, 27(2): 329-334.
 +
</ref>
 +
* <ref name="ref2">
 +
Murakami T, Matsuba S, Funatsuki H, et al. Over-expression of a small heat shock protein, sHSP17. 7, confers both heat tolerance and UV-B resistance to rice plants[J]. Molecular Breeding, 2004, 13(2): 165-175.
 +
</ref>
 +
* <ref name="ref3">
 +
Zou J, Liu A, Chen X, et al. Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment[J]. Journal of plant physiology, 2009, 166(8): 851-861.
 +
</ref>
 +
* <ref name="ref4">
 +
Vierling E. The roles of heat shock proteins in plants[J]. Annual review of plant biology, 1991, 42(1): 579-620.
 +
</ref>
 +
* <ref name="ref5">
 +
Trent J D. A review of acquired thermotolerance, heat‐shock proteins, and molecular chaperones in archaea[J]. FEMS microbiology reviews, 1996, 18(2‐3): 249-258.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 09:39, 3 March 2015

sHSP17.7 is a small heat-shock protein gene in rice[1][2].

Annotated Information

Function

The molecular chaperone activity of sHSP17.7 was investigated using catalase as a substrate. Recombinant sHSP17.7 had heat-stable chaperone properties that were capable of protecting stressed catalase from precipitation[2].

Mutation

  • Drought tolerance was assessed in the transgenic lines and wild-type plants by withholding water for 6 days for evaluation of the ability of plants to continue growth after water-stress treatments. Although no significant difference was found in water potential of seedlings between transgenic lines and wildtype plants at the end of drought treatments, only transgenic seedlings with higher expression levels of sHSP17.7 protein could regrow after rewatering. Similar results were observed in survival rates after treatments with 30% polyethylene glycol (PEG) 3640 for 3 days[1].
  • After heating, the survival rate of sHSP17.7 cells was 2-fold higher than that of the control cells[2].
  • Transgenic rice plants with increased levels of sHSP17.7 protein exhibited significantly increased thermotolerance compared to untransformed control plants. The level of increased thermotolerance was correlated with the level of increased sHSP17.7 protein in the transgenic plants[2].

Expression

  • Western and Northern blot analyses showed higher expression levels of sHSP17.7 protein in three transgenic lines than in one transgenic line. Overproduction of sHSP17.7 could increase drought tolerance in transgenic rice seedlings. [1]. Overexpression of sHSP17.7 in rice confers higher thermotolerance and UV-B resistance[2].
  • sHSP17.7 was overexpressed in the rice cultivar ‘Hoshinoyume’, by Agrobacterium-mediated transformation, under the control of a CaMV 35S promoter[2].
  • The transgenic rice plant with the highest constitutive expression of sHSP17.7 had significantly greater resistance to UV-B stress than untransformed control plants. Increase in the degree of resistance of transgenic plants to UV-B was accompanied by an increase in production of sHSP17.7 protein[2].

Evolution

Figure 1.Gene tree of the nine rice HSPs(from reference [3]).
  • Gene tree were conducted using the software Molecular Evolutionary Genetics Analysis (MEGA) Version 4.0 by the neighbor-joining method with pairwise deletion and the Poisson correction model[3].
  • As shown in Figure 1, based on amino acids sequence homology, nine OsHSP genes were divided into three classes, among them OsHSP80.2, OsHSP74.8 and OsHSP50.2 belong to HSP90 family; OsHSP71.1, OsHSP58.7 and OsHSP23.7 belong to HSP70 family; OsHSP26.7, OsHSP17.0, OsHSP24.1 and OsHSP17.0 belong to sHSP family[3].

Knowledge Extension

  • Heat shock proteins (Hsps) belong to a class of proteins that are conserved in prokaryotes and eukaryotes and are especially abundant in plants. Hsps are highly expressed in plants and other organisms after being stimulated by high temperature and other stresses. The sHsps are much more abundant in higher plants than in other organisms[4].
  • Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses[3].
  • According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs[5]. Most HSPs function as molecular chaperones in maintaining homeostasis of protein folding and are thought to be responsible for the acquisition of thermo tolerance[4]. It is believed that the accumulations of HSPs play a pivotal role in abiotic stress.

Labs working on this gene

  • National Agricultural Research Center for Hokkaido Region, Hitsujigaoka 1, Toyohira-ku, Sapporo 062-8555, Japan
  • Hokkaido Green-Bio Institute, Naganuma, Hokkaido 069-1301, Japan;

References

  1. 1.0 1.1 1.2 Sato Y, Yokoya S. Enhanced tolerance to drought stress in transgenic rice plants overexpressing a small heat-shock protein, sHSP17. 7[J]. Plant cell reports, 2008, 27(2): 329-334.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Murakami T, Matsuba S, Funatsuki H, et al. Over-expression of a small heat shock protein, sHSP17. 7, confers both heat tolerance and UV-B resistance to rice plants[J]. Molecular Breeding, 2004, 13(2): 165-175.
  3. 3.0 3.1 3.2 3.3 Zou J, Liu A, Chen X, et al. Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment[J]. Journal of plant physiology, 2009, 166(8): 851-861.
  4. 4.0 4.1 Vierling E. The roles of heat shock proteins in plants[J]. Annual review of plant biology, 1991, 42(1): 579-620.
  5. Trent J D. A review of acquired thermotolerance, heat‐shock proteins, and molecular chaperones in archaea[J]. FEMS microbiology reviews, 1996, 18(2‐3): 249-258.

Structured Information

Gene Name

Os03g0267200

Description

Low molecular mass heat shock protein Oshsp17.7

Version

NM_001056197.1 GI:115452122 GeneID:4332363

Length

707 bp

Definition

Oryza sativa Japonica Group Os03g0267200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:8888484..8889190

Sequence Coding Region

8888694..8889173

Expression

GEO Profiles:Os03g0267200

Genome Context

<gbrowseImage1> name=NC_008396:8888484..8889190 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:8888484..8889190 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgctgatccgccgcggcaacgcgttcgaccccttctccctcgacctctgggatcccgtcgacggcttccccttcggctccggcggcagcagcagcagcagcggcagcctcttccctcgggccaactccgacgcggcggccttcgccggcgcgcgcatcgactggaaggagacgcccgaggtgcacgtgttcaaggcggacgtgccggggctgaagaaggaggaggtcaaggtggaggtggacgacggcaacatcctgcagatcagcggcgagcgcagcagggagcaggaggagaagtcggacaagtggcaccgcgtggagcgcagcagcggcaagttcctccgcaggttccgcctccccgagaacaccaagccggagcagatcaaggcgtccatggagaatggcgtgctcaccgtcaccgtgcccaaggaagagcccaagaagcccgacgtcaagtccatccagatctccggctag</cdnaseq>

Protein Sequence

<aaseq>MSLIRRGNAFDPFSLDLWDPVDGFPFGSGGSSSSSGSLFPRANS DAAAFAGARIDWKETPEVHVFKADVPGLKKEEVKVEVDDGNILQISGERSREQEEKSD KWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVTVPKEEPKKPDVKSIQISG</aaseq>

Gene Sequence

<dnaseqindica>18..497#gcccaaatccgtcaaccatgtcgctgatccgccgcggcaacgcgttcgaccccttctccctcgacctctgggatcccgtcgacggcttccccttcggctccggcggcagcagcagcagcagcggcagcctcttccctcgggccaactccgacgcggcggccttcgccggcgcgcgcatcgactggaaggagacgcccgaggtgcacgtgttcaaggcggacgtgccggggctgaagaaggaggaggtcaaggtggaggtggacgacggcaacatcctgcagatcagcggcgagcgcagcagggagcaggaggagaagtcggacaagtggcaccgcgtggagcgcagcagcggcaagttcctccgcaggttccgcctccccgagaacaccaagccggagcagatcaaggcgtccatggagaatggcgtgctcaccgtcaccgtgcccaaggaagagcccaagaagcccgacgtcaagtccatccagatctccggctagagccccgtttgtttattctgctgcttctcctcaatgctgcaattgatctcctcctttggtactttgcttgtgtcgtgagggacacagtccaaaatgtgtgtgatatgatcatgtgtttatgaatgtgtggtctcctccaagggtcccaaatgtgtttgtctcctatgcgtttatgtacgggaaataaactttaagcttgattaatgtacc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0267200, RefSeq:Os03g0267200